Dbfetch

ID   AF215637; SV 1; linear; mRNA; STD; MUS; 2111 BP.
XX
AC   AF215637;
XX
DT   06-JUL-2000 (Rel. 64, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus SLC11A3 iron transporter mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2111
RX   DOI; 10.1074/jbc.M000713200.
RX   PUBMED; 10747949.
RA   Abboud S., Haile D.J.;
RT   "A novel mammalian iron-regulated protein involved in intracellular iron
RT   metabolism";
RL   J Biol Chem 275(26):19906-19912(2000).
XX
RN   [2]
RP   1-2111
RX   PUBMED; 10828623.
RA   Haile D.J.;
RT   "Assignment of Slc11a3 to mouse chromosome 1 band 1B and SLC11A3 to human
RT   chromosome 2q32 by in situ hybridization";
RL   Cytogenet. Cell Genet. 88(3-4):328-329(2000).
XX
RN   [3]
RP   1-2111
RA   Haile D.;
RT   ;
RL   Submitted (12-DEC-1999) to the INSDC.
RL   Medicine, UTHSCSA, 7703 Floyd Curl Drive, San Antonio, TX 78240, USA
XX
DR   MD5; c68b7037e0dc29c8cedafa8746b0ad76.
DR   Ensembl-Gn; ENSMUSG00000025993; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0015996; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0015980; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0015935; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015934; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015767; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016387; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015349; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0015739; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0015840; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0015842; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0015910; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015862; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016434; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015133; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015410; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000027137; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019694; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0019671; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0019628; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019620; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019449; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020119; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0018956; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0019403; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0019517; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0019523; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0019605; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019493; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020173; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018713; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019044; mus_musculus_wsbeij.
DR   RFAM; RF02253; IRE_II.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2111
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   misc_feature    50..89
FT                   /note="iron response element"
FT   CDS             285..1997
FT                   /codon_start=1
FT                   /product="SLC11A3 iron transporter"
FT                   /note="ferroportin 1; ireg1"
FT                   /db_xref="GOA:Q9JHI9"
FT                   /db_xref="InterPro:IPR009716"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1315204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JHI9"
FT                   /protein_id="AAF80987.1"
FT                   /translation="MTKARDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFA
FT                   VSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVI
FT                   LCGIILMMVFLHKNELLTMYHGWVLTVCYILIITIANIANLASTATAITIQRDWIVVVA
FT                   GENRSRLADMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYFL
FT                   LWKVYQKTPALAVKAALKVEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQE
FT                   PTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGS
FT                   ILSILMGASAITGIMGTVAFTWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLD
FT                   LSVSPFEDIRSRFVNVEPVSPTTKIPETVFTTEMHMSNMSNVHEMSTKPIPIVSVSLLF
FT                   AGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPE
FT                   AFGLLVLISVSFVAMGHLMYFRFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV"
XX
SQ   Sequence 2111 BP; 520 A; 491 C; 504 G; 596 T; 0 other;
     ggggtctctg cggccggtgg atctccaacc cgctcccata aggctttggc tttccaactt        60
     cagctacagt gttagctaag tttggaaaga agacaaaaag aagaccccgt gacagctttg       120
     ctgttgttgt ttgccttagt tgtcctttgg ggtctttcgg cataaggctg ttgtgcttat       180
     actggtgcta tcttcggttc ctctcactcc tgtgaacaag ctcccgggca agagcagcta       240
     aagctaccag catcagaaca aacaagggga gaacgcctgg tgtcatgacc aaggcaagag       300
     atcaaaccca tcaggaagga tgctgtggat ccttagcaaa ctacctgacc tcagcaaaat       360
     tcctcctcta ccttggccac tctctctcca cttgggggga tcggatgtgg cactttgcag       420
     tgtctgtgtt tctggtggaa ctctatggaa acagccttct cttgacagct gtctatggac       480
     tggtggtggc aggctctgtt ctggtcctgg gagccatcat tggtgactgg gtggataaga       540
     atgccagact taaagtggcc cagacgtcac tggtggttca gaatgtgtcc gtcatcctct       600
     gcggaatcat cctgatgatg gttttcctac acaagaatga gctcctgacc atgtaccatg       660
     gatgggtcct tactgtctgc tacatcctga tcatcactat tgcaaacatt gcaaatttgg       720
     ccagtactgc cactgcgatc acaatccaaa gggactggat tgttgttgtg gcaggagaaa       780
     acaggagcag attagcagac atgaatgcta ccattagaag gattgaccag ctaaccaaca       840
     tcctggcccc catggctgtc ggccagatta tgacatttgg ttctccagtc attggctgtg       900
     gttttatttc cggttggaat ttggtgtcca tgtgtgtgga gtacttcttg ctctggaagg       960
     tttaccagaa gacccctgct ctggctgtaa aagctgctct caaggtagag gagtcagaac      1020
     tgaagcagct gacctcacct aaagatactg agccaaaacc tttggaggga actcatctaa      1080
     tgggtgagaa agactccaac atccgtgaac ttgaatgtga acaagagccc acctgtgcct      1140
     cccagatggc agagcccttc cgcactttcc gagatggatg ggtctcctac tataaccagc      1200
     cagtgtttct ggctggcatg ggcctggctt tcctctatat gacagtcctg ggctttgact      1260
     gtatcactac agggtacgcc tacactcagg ggctgagtgg atccatcctt agtattttga      1320
     tgggagcatc agcaataact ggaataatgg gaactgtggc cttcacctgg ctacgtcgaa      1380
     aatgtggcct tgttcggact ggtctattct caggactagc ccagctttcc tgtttaatct      1440
     tgtgtgtgat ctccgtattc atgcctggaa gccccttgga cctgtctgtt tctccatttg      1500
     aagatatccg ttctaggttt gtgaatgtgg agccagtgtc cccaactacc aaaatacctg      1560
     agaccgtctt tacaacagaa atgcatatgt ccaacatgtc taatgtccat gagatgagta      1620
     ctaaacccat ccccatagtc tctgtcagcc tgctgtttgc aggagtcatt gctgctagaa      1680
     tcggtctttg gtcctttgat ttgacggtga cacagttgct gcaagaaaat gtaattgaat      1740
     ctgaaagagg cattatcaat ggtgtgcaga actccatgaa ctaccttctt gaccttctgc      1800
     atttcatcat ggtcatcttg gccccaaatc ctgaagcttt tggcttgctg gtattgattt      1860
     cagtctcctt tgtggcaatg ggacatctta tgtatttccg atttgcccag aagactctgg      1920
     gcaaccagat ttttgtttgt ggtcctgatg aaaaagaagt tacagatgaa aatcaaccga      1980
     atacatctgt tgtataaaaa tagtttagct gtggcccctg ttactagatt gtggagagca      2040
     tgtgtgctta ttttgtactg cagaatccca ataaatgcct gcatttctca aaaaaaaaaa      2100
     aaaaaaaaaa a                                                           2111
//