spacer

EBI Dbfetch

ID   AF214575; SV 1; linear; mRNA; STD; MUS; 441 BP.
XX
AC   AF214575;
XX
DT   16-FEB-2000 (Rel. 62, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus glycine receptor alpha 3 subunit mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-441
RX   DOI; 10.1016/S0306-4522(01)00130-0.
RX   PUBMED; 11457589.
RA   Sergeeva O.A., Haas H.L.;
RT   "Expression and function of glycine receptors in striatal cholinergic
RT   interneurons from rat and mouse";
RL   Neuroscience 104(4):1043-1055(2001).
XX
RN   [2]
RP   1-441
RA   Sergeeva O.A., Haas H.L.;
RT   ;
RL   Submitted (10-DEC-1999) to the INSDC.
RL   Neurophysiology, Heinrich-Heine-University, Universitaetsstr. 1, POB
RL   101007, Duesseldorf, NRW D-40001, Germany
XX
DR   MD5; 835a98fab33e49c7382f87ff1e4a8b4f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..441
FT                   /organism="Mus musculus"
FT                   /chromosome="8"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /cell_line="cholinergic interneurons"
FT                   /tissue_type="dorsal striatum"
FT                   /note="centromere-Plat-Glra3-Cph-telomere"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>441
FT                   /codon_start=1
FT                   /product="glycine receptor alpha 3 subunit"
FT                   /note="Glra3"
FT                   /db_xref="GOA:Q9JL29"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="MGI:MGI:95749"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JL29"
FT                   /protein_id="AAF34619.1"
FT                   /translation="DLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLP
FT                   QFLLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWI
FT                   NMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWM"
XX
SQ   Sequence 441 BP; 128 A; 101 C; 95 G; 117 T; 0 other;
     gacctgaaga actttccaat ggatgtacaa acatgcataa tgcaacttga aagctttggg        60
     tacacaatga atgatctcat ttttgaatgg caagatgaag ccccagtaca agtggctgaa       120
     ggactcactt tgcctcaatt tctgttgaaa gaagaaaagg acttgcggta ctgcactaaa       180
     cactacaata caggaaagtt tacatgcata gaagtgcgat tccatcttga gcgtcagatg       240
     ggctattact tgatccagat gtacatcccc agcctcctga tcgttattct atcctgggtc       300
     tcattctgga ttaacatgga tgcagcccca gctagagtag ctttgggcat caccactgta       360
     cttactatga ccacacagag ttctggatcc cgggcctcct taccaaaggt gtcatacgtc       420
     aaggcaattg acatctggat g                                                 441
//


spacer
spacer