spacer

EBI Dbfetch

ID   AF212372; SV 1; linear; mRNA; STD; MUS; 2211 BP.
XX
AC   AF212372;
XX
DT   02-JAN-2001 (Rel. 66, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus spinster-like protein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2211
RX   DOI; 10.1128/MCB.21.11.3775-3788.2001.
RX   PUBMED; 11340170.
RA   Nakano Y., Fujitani K., Kurihara J., Ragan J., Usui-Aoki K., Shimoda L.,
RA   Lukacsovich T., Suzuki K., Sezaki M., Sano Y., Ueda R., Awano W.,
RA   Kaneda M., Umeda M., Yamamoto D.;
RT   "Mutations in the novel membrane protein spinster interfere with programmed
RT   cell death and cause neural degeneration in Drosophila melanogaster";
RL   Mol. Cell. Biol. 21(11):3775-3788(2001).
XX
RN   [2]
RP   1-2211
RA   Nakano Y., Yamamoto D.;
RT   ;
RL   Submitted (08-DEC-1999) to the INSDC.
RL   Pioneering Research, Mitsubishi Kasei Institute of Life Sciences, 11,
RL   Minamiooya, Machida, Tokyo 194-8511, Japan
XX
DR   MD5; 67a9f64844577c75ba5eeaef978a51bb.
DR   Ensembl-Gn; ENSMUSG00000030741; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032994; mus_musculus.
DR   EuropePMC; PMC87027; 11340170.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2211
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             349..1935
FT                   /codon_start=1
FT                   /product="spinster-like protein"
FT                   /note="similar to Drosophila spinster protein; SPIN1"
FT                   /db_xref="GOA:Q8R0G7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1920908"
FT                   /protein_id="AAG43831.1"
FT                   /translation="MAGSDTAPFLSQADDPDDGPAPGHPGLPGPMGNPKSGELEVPDCE
FT                   GLQRITGLSRGHSTLIVVVLCYINLLNYMDRFTVAGVLTDIEQFFNIGDGSTGLIQTVF
FT                   ISSYMVLAPVFGYLGDRYNRKYFMCGGIAFWSLVTLGSSFIPREHFWLLFLTRGMVGVG
FT                   EASYSTIAPTLIADFFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDVAGDWHWALRV
FT                   TPGLGVLAVLLLFLVVQEPPRGAVERHSGSPPLSPTSWWADLKALARNPSFVLSSLGFT
FT                   SVAFVTGSLALWAPAFLLRSRVVLGETPPCLPGDSCSSSDSLIFGLITCLTGVLGVGLG
FT                   MEISRRLRRFNPRADPLVCAAGLLGSAPFLFLALACARGSIVATYIFIFIGETLLSMNW
FT                   AIVADILLYVVIPTRRSTAEAFQIVLSHLLGDAGSPYLIGLISDRLRRSWPPSFLSEFR
FT                   ALQFSLMLCAFVGALGGAAFLGTAMFIEDDRRRAQLHVQGLLHESGPSDDRIVVPQRGR
FT                   STRVPVSSVLI"
XX
SQ   Sequence 2211 BP; 391 A; 647 C; 647 G; 526 T; 0 other;
     ggcacgaggc ttgggcaaca tggcggcagt tgtgttgctg gagcttggaa ctgagcaaca        60
     gcggagtgtg gcgcgctcct ttcccgggct ttgggagtgc gtcagcgtga gaagagggac       120
     tgggtcctgg tcttcctgct cctgtcccag cgtcacctgc acctcctgtg tgctctcctc       180
     tgtcggaacc agagggaatg acgaagccca gggcttttcg cagtggtgca ctgtgcatcg       240
     gaccacgctc ctaggcgata gtgggcaagt cttctcgcag tcctctctcc aacctccttc       300
     cgtcggaggt aggaccgaag cgtgggcggt tgcgattccc cagggaccat ggccgggtcc       360
     gacacggcgc ccttcctcag ccaagcagat gatcctgatg acgggccagc gcccggccat       420
     ccggggttgc caggacccat ggggaatcca aagtccgggg aactcgaggt cccagactgt       480
     gaggggctac agcgcatcac tggcttatct cggggccatt cgaccctcat agtggtggtt       540
     ctgtgctaca ttaacctcct gaactacatg gaccgcttca ccgtggcagg ggttcttaca       600
     gacatcgagc agttctttaa catcggagat ggtagtactg gcctcatcca gactgtgttc       660
     atctccagtt acatggtgtt ggcaccagtg tttggctacc tgggtgacag gtacaatcga       720
     aagtacttca tgtgcggggg cattgccttc tggtccctgg tgacactggg atcatccttc       780
     atccccagag agcatttctg gctgcttttc ctgacccggg gcatggtggg ggtcggggag       840
     gccagttact ccaccattgc gcccaccctg atcgccgact tcttcgtggc agaccagcgg       900
     agtcggatgc tcagtatttt ctactttgcc atccctgtgg gcagtggtct aggttacatt       960
     gctggctcca aagtgaaaga cgtggctgga gactggcact gggctctacg ggtgacacca      1020
     ggtctaggag tgctggctgt cctgctgctg ttcctggtgg tccaggagcc cccaagagga      1080
     gccgtggagc gccactcagg ttcaccaccc ctgagcccca cttcttggtg ggcagatctg      1140
     aaggcactgg cacgaaatcc tagtttcgtc ctgtcttccc ttggcttcac ctctgtggcc      1200
     tttgtcacgg gctccctggc tctctgggcc ccagcgttcc tgctgcgctc ccgggttgtt      1260
     ctgggagaga ctccgccctg tctccctgga gattcatgct cttcctctga cagtctcatc      1320
     tttggactca tcacttgcct gactggagtc ctgggtgtgg gcctgggaat ggagatcagc      1380
     cgccgccttc gccgcttcaa ccctcgggct gacccactcg tctgtgcagc tggcctcctg      1440
     ggttcggcgc ctttcctctt cctggccctg gcctgtgccc gaggtagcat cgtggccacc      1500
     tatattttta tctttattgg ggagaccctg ttgtccatga actgggccat tgtggctgac      1560
     atcctgttgt acgtggtgat cccaactcga cggtccacgg ctgaggcctt ccagatagtg      1620
     ctgtcccact tgctaggaga tgcagggagc ccttacctca ttggtctaat ctctgaccgc      1680
     ctccgacgga gctggccccc ttccttcctg tccgagttcc gggctctgca gttctcgctc      1740
     atgctctgtg ctttcgttgg ggcactgggt ggtgcggcct tcctgggcac cgccatgttc      1800
     attgaagatg accgccggcg ggctcaactc cacgtgcagg gtctgttgca tgagtctggg      1860
     ccctcagatg accggattgt agtacctcag cgaggccgtt ctacccgagt ccccgtgtcc      1920
     agcgtgctca tttgaggagc cggtgcttac ccggccactg atgcatcgca gctgggcctt      1980
     gggcccaccc aagacggttc ccaggcagaa gccctcacca ggcccaggtc caagaaggaa      2040
     gccctgggat atttcccagc tcccagacaa tacatgggca gcccagggaa gagatgggag      2100
     tccagaaacg gggaaggggt gtccttttta ctaggacagc ccaaggggtt tggtgctatt      2160
     tgtaatggaa taaaatttgt aatcagaaaa aaaaaaaaaa aaaaaaaaaa a               2211
//


spacer
spacer