spacer

EBI Dbfetch

ID   AF211855; SV 1; linear; mRNA; STD; MUS; 5964 BP.
XX
AC   AF211855;
XX
DT   31-JUL-2001 (Rel. 68, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus K-Cl cotransporter 3b mRNA, complete cds, alternatively
DE   spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5964
RX   DOI; 10.1016/S0306-4522(00)00567-4.
RX   PUBMED; 11246162.
RA   Pearson M.M., Lu J., Mount D.B., Delpire E.;
RT   "Localization of the K(+)-Cl(-) cotransporter, KCC3, in the central and
RT   peripheral nervous systems: expression in the choroid plexus, large neurons
RT   and white matter tracts";
RL   Neuroscience 103(2):481-491(2001).
XX
RN   [2]
RP   1-5964
RX   DOI; 10.1152/ajprenal.00464.2004.
RX   PUBMED; 16048901.
RA   Mercado A., Vazquez N., Song L., Cortes R., Enck A.H., Welch R.,
RA   Delpire E., Gamba G., Mount D.B.;
RT   "NH2-terminal heterogeneity in the KCC3 K+-Cl- cotransporter";
RL   Am. J. Physiol. Renal Physiol. 289(6):F1246-F1261(2005).
XX
RN   [3]
RP   1-5964
RA   Mount D.B., Song L.S., Delpire E.;
RT   ;
RL   Submitted (03-DEC-1999) to the INSDC.
RL   Nephrology, Vanderbilt University Medical Center, S-3223 Medical Center
RL   North, VUMC, Nashville, TN 37232, USA
XX
DR   MD5; bf0fdf3c64d1b55c45ef56f701e69e96.
DR   Ensembl-Gn; ENSMUSG00000027130; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053666; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5964
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..3300
FT                   /codon_start=1
FT                   /product="K-Cl cotransporter 3b"
FT                   /note="KCC3b; includes alternative exon 1b; alternatively
FT                   spliced"
FT                   /db_xref="GOA:Q924N4"
FT                   /db_xref="InterPro:IPR000076"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR004842"
FT                   /db_xref="InterPro:IPR018491"
FT                   /db_xref="MGI:MGI:2135960"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q924N4"
FT                   /protein_id="AAK81896.1"
FT                   /translation="MPHFTVTKVEDPEEGAAGPLSPEPSSAEVKARIQDPQEPDPSQNS
FT                   ITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMAN
FT                   YTNLTQGAKEHEEAENITEGKKKPTKSPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGT
FT                   AGILQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFY
FT                   LGTTFAAAMYILGAIEIFLVYIVPRAAIFRSDDALKESAAMLNNMRVYGTAFLVLMVLV
FT                   VFIGVRYVNKFASLFLACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTLSSRHLDICS
FT                   KTKEVDNMTVPSKLWGFFCNSSQFFNATCDEYFVHNNVISIQGIPGLASGIITENLWSN
FT                   YLPKGEIIEKPSAKSSDVLGNLNHEYVLADITTSFTLLVGIFFPSVTGIMAGSNRSGDL
FT                   KDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPS
FT                   PWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKANGEPTWALLLTA
FT                   AIAELGILIASLDLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFM
FT                   GMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFALLRL
FT                   EEGPPHTKNWRPQLLVLLKLDEDLHVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENY
FT                   GDALAAEQTIKHLMEAEKVKGFCQLVVAAKLKEGISHLIQSCGLGGMKHNTVVMGWPNG
FT                   WRQSEDARAWKTFIGTVRVTTAAHLALLVAKNVSFFPSNVEQFSEGNIDVRWIVHDGGM
FT                   LMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMHDS
FT                   DISAYTYERTLMMEQRSQMLRHMRLSKTERDREAQLVKDRNSMLRLTSIGSDEDEETET
FT                   YQEKVHMTWTKDKYMASRGQKVKSMEGFQDLLNMRPDQSNVRRMHTAVKLNEVIVNKSH
FT                   EAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS"
XX
SQ   Sequence 5964 BP; 1608 A; 1385 C; 1347 G; 1624 T; 0 other;
     atgccacatt ttactgtgac caaggtagaa gacccagagg agggggcagc tggccccctc        60
     tctcctgagc ccagctcagc agaagtaaaa gcccggattc aggatcccca agaaccagac       120
     ccgagtcaga actccatcac aggggagcac agccagctgt tagatgacgg ccataaaaaa       180
     gcccgaaatg cttatctcaa taattccaac tatgaagaag gagacgaata ttttgataaa       240
     aatttggcac tctttgagga agaaatggac accagaccaa aggtgtcttc tctcctcaac       300
     cgcatggcca actatacaaa tctgacacaa ggagcaaagg aacatgaaga ggcagagaac       360
     atcactgaag ggaaaaagaa gcctaccaag agcccccaaa tgggtacttt catgggtgtc       420
     tacctcccat gtctacagaa catctttgga gtgatcctct tcctgcgtct tacctgggta       480
     gtgggaacag ctggaatcct tcaggccttt gcaattgtcc tcatctgctg ctgctgtaca       540
     atgttaactg ccatctccat gagcgccatc gccactaacg gagtggtgcc agctgggggc       600
     tcatacttca tgatttccag agccctgggc ccagagtttg gcggggctgt aggcctctgc       660
     ttttatcttg gcaccacatt tgcagcagcc atgtatattc ttggtgccat tgaaatcttt       720
     ctggtataca ttgtcccccg agctgccatc tttcggagtg acgatgcact caaggagtca       780
     gcagctatgc tgaacaacat gcgcgtctat ggtacagcct tcttggtcct catggtcttg       840
     gtggtattca tcggcgtacg ctatgtgaat aagtttgcct cactcttcct ggcctgtgta       900
     attgtgtcga tcttggctat ctatgctggt gccatcaagt cttcctttgc tccaccacac       960
     ttcccggtct gtatgctggg caaccgtacc ctgtcatcaa gacaccttga catttgctct      1020
     aagaccaagg aggttgacaa catgacagta ccatcaaagt tatggggatt cttctgcaac      1080
     tcgagtcagt tctttaatgc cacctgtgat gagtactttg ttcacaataa cgtcatctca      1140
     atccaaggca ttccagggtt ggctagtggt atcattactg aaaatctttg gagtaattat      1200
     ttaccaaagg gtgagataat tgaaaagcca tcagccaagt catctgatgt cttaggcaac      1260
     ttaaaccatg aatatgttct tgctgatatc accacctcct tcactctgct ggtggggatc      1320
     ttctttccct cggtcacagg tatcatggct gggtcaaaca gatctggaga tctgaaagat      1380
     gcccagaagt ctattcccat tgggaccatc cttgccatcc tgaccacatc ctttgtgtat      1440
     ttaagcaatg ttgtcctttt tggtgcatgt attgaaggag tcgttctcag agacaaattt      1500
     ggggatgctg taaaagggaa tttggttgta ggcaccttat cctggccatc cccgtgggtg      1560
     atcgttattg gctccttctt ttcaacatgt ggggctgggc tgcagagcct cacaggtgcg      1620
     cctcggctgc tgcaggctat cgccaaggat aacatcatac ctttccttag ggtttttggt      1680
     cacagcaaag ctaatgggga acctacctgg gctttacttc taactgctgc catagcagag      1740
     ctgggaattc tcatcgcctc cctggatctc gtggccccaa ttctttccat gttttttctc      1800
     atgtgttacc tctttgtgaa cttggcttgt gccttgcaaa cattgctgcg aacccccaac      1860
     tggaggcctc gattccgcta ttatcactgg gccctctctt tcatgggaat gagtatctgt      1920
     ctagctctga tgttcatttc ttcttggtat tatgccattg tagctatggt aatagctggc      1980
     atgatctaca agtacattga atatcaaggg gctgagaaag aatgggggga tggtatccgt      2040
     gggctgtcgc tcagtgcagc ccgcttcgct ttgctccgtc tagaggaagg acctcctcac      2100
     actaaaaact ggaggcctca gctgctcgtc ctactgaagc tggatgaaga tttacacgtc      2160
     aagcaccctc gcctcctcac ctttgcctcc cagctcaagg caggaaaggg actcacgatt      2220
     gtgggctctg tcatcgtggg gaacttcttg gagaactatg gtgacgcgct cgcggcagag      2280
     cagaccatta agcacctaat ggaggcagaa aaggtaaaag gattctgcca attggtggtg      2340
     gctgccaagc tgaaagaggg catttcacac ctcatccagt cctgtggcct cggaggcatg      2400
     aaacacaaca cagtggtgat gggctggccc aatggctggc gtcagagtga agatgctcgc      2460
     gcttggaaga ctttcattgg cacagtacga gtgacaactg ctgcccatct agccctgctg      2520
     gtggctaaaa atgtctcctt ctttcccagc aatgtggagc agttttctga gggcaacatt      2580
     gatgtgcggt ggattgtgca tgatgggggc atgctcatgc tattaccgtt cctgctgaaa      2640
     cagcacaagg tttggcggaa atgcagcata cggatcttca cagtagccca actagaagac      2700
     aacagtatcc agatgaagaa ggatctggcc acctttctgt accacctgcg cattgaggca      2760
     gaagtggaag tggtggagat gcacgacagt gacatatctg cctatacata tgagcgcacc      2820
     ctgatgatgg agcagaggtc ccagatgctt cggcatatgc ggctgtccaa aacagagcga      2880
     gacagggagg cacagctggt gaaagatcga aactcaatgc tacgcttgac cagcattggc      2940
     tctgatgagg acgaagagac agaaacgtac caggagaagg tgcacatgac ttggaccaag      3000
     gataaataca tggcatcccg ggggcaaaag gtcaagtcaa tggaaggatt ccaggaccta      3060
     cttaatatgc gtccggacca gtccaacgtg agacggatgc atacagcagt gaagctcaat      3120
     gaagttatag tcaacaagtc tcatgaagca aagctggttt tgttgaatat gccaggacca      3180
     ccccggaacc ctgaaggtga tgaaaactac atggaatttc tagaagtgct cactgaggga      3240
     ttagaacgag tccttcttgt ccggggtggt ggcagtgagg tcatcaccat ttactcataa      3300
     tcagctgtgg gagattctgc gtggtccgac ttccctaaga ctcatcgtcc atggagatga      3360
     tagctctttc ctaccactcc cactctattc ttgcagagct gagccccatc tatgctcttg      3420
     gctgcaacat gatctgccat cccagcagaa acaaataatc cctcaacaga agaatggtca      3480
     agtcctaaaa gctatttcta tggcaggaga aggcaagtca aaattaacaa gctaagccaa      3540
     agggaacctt ttggcacaca gaaggtaatg agttagtaaa acatatgcta gaaatgtaac      3600
     tggcaacaga aagcaatgtt catatctaac attcaggacg agtttcagaa gacacgggtc      3660
     agtgagcacc agaaagttaa caggcagtta agcttcacct tagtaaaaaa tgagttccca      3720
     ttatagagac agcctgcagc agccaggatg gaaacaggat actgatatat aaaacctgag      3780
     acatagctgc agccactact tcttcctcat ggtttattgt ctgtactgta ccactgtaca      3840
     ttttaactgt ctttgtttta aaacccattc tgtggttata atgcagacag tagtgttact      3900
     atagaaatgt ttttttgaaa ggctagaaat gttttttcag gttttcaaat gctgaactaa      3960
     ggggattcca aagagtgcgt attaaaatat atagaaacac agtggttagc tatgcaacat      4020
     aaagcacaca agctattatc ttaacaaatg tgggttgtta tgtagttaac cagaagggtc      4080
     tcttctactc ttagtaggca ttggtcttaa aaaccaaaca aaccaaacct gtaaggaaga      4140
     gacgccaggg ctgtgtgatg ccacctccaa ggccccaggg ttcagaggtt cagcagtgga      4200
     actgggggtg tgaaagccat accctttcca ctgtgccaaa atcgtctgct cactggcaga      4260
     caggtttgca agtggcctga cacaagcacc ttttctttca caagaaatcc atctgtggcc      4320
     tcttcaccaa agccatagtg cagatttgag gcactcgacc tccatgccca gagcttttcc      4380
     cgtctcaata ttattattat tcattctgac ttcggaaact tggctctgaa acaaatggtt      4440
     cactaagcta atgatctgct gtattggttt tgctttcaaa aagctctaac tgtgccaagg      4500
     aaatacttgt gtaagatcag attttttttt tttttttaat ttactgatca caaacacttg      4560
     gcttaccagc ataggcagcc tttgtggctg agcagtattc ccagggtgtg aaacctccat      4620
     accctttcca agatagttac tgaagaaact gtcttcttgc ttagattcac ggctgctttt      4680
     acatttcctt tcactgacag taaattgtgc cactctccat accctgtagg acaatgaaca      4740
     cccagaattc aacccaagac agaagaaaac cctcaaatat ggcttaagaa gctgagtcat      4800
     atggtttgtt cttcctcctc ccaggcccac ttgagtagca aaggatccag catgttttcc      4860
     tttgcttcct gcagagggta gaaactactc gtagttctct ttccaacact ccattgcata      4920
     cttgagtata atcccctagg ctccaaggca ttggagcgcc cattctgtaa aagccagcct      4980
     gcccaggaac tgcctaacac atccacccct gaccaaagtg acacatactt tttccatatc      5040
     aaacaaacat gggaagagaa taaggtttct ttaagaaagg ctgtttgtgg ttagagctac      5100
     ataagaatct gttaaagggt agagtatagt cttcattccc caagataaaa atcactgtta      5160
     catggacaaa tggttattag gccagatttg tactcatctc tgtctagaac atttcatgtc      5220
     tatgtgttgc ttatgttgtc tgtctgcaaa gtgtcttagc tcttttaatc actgcaaata      5280
     aagcaatact gaaaacttga gagagaaaat gcaccttagg ggaaggggcc aaatgtttct      5340
     agagggaaga ggaagacctt ctcctgcctt tcttataaga cccagcttgt gtcttaccca      5400
     tgagtttatt agcagggcag gctgtaacat tcgttctccc ccaactggtc ctcagccttc      5460
     cgtagctacc ttaaaagctg gagtttgaat tgcagggcct ggttgacagg tgccagcttc      5520
     ctcgtggcag agcaaaagct gctgcttttc atattctgtg cctccttttc ttgtggcccc      5580
     aaggatccca ccaatcctca ttccccctaa atgttaaaag aaaattcctt attgtggata      5640
     ttaagttaca ctgtaagcat atttacatgc tctttttccc ccctggtttt tcttttcatc      5700
     atgtataatt tgaatccagt gatagtctca catcttccaa aaaagtctgc ttatgtgata      5760
     tagaagagaa atattaaagt agactgaagg ggaacttgtg aaacattaag cattgttctc      5820
     aaccgtttaa tttattgaaa ggagaagctg ctactgagca gctgctattc ttttgtttac      5880
     atagagtctg gttttgtttg ttttgctctg tgctgggaac ataaataaag ttttctacat      5940
     tattttcaaa aaaaaaaaaa aaaa                                             5964
//


spacer
spacer