Dbfetch

ID   AF211854; SV 1; linear; mRNA; STD; MUS; 6120 BP.
XX
AC   AF211854;
XX
DT   31-JUL-2001 (Rel. 68, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus K-Cl cotransporter 3a mRNA, complete cds, alternatively
DE   spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-6120
RX   DOI; 10.1016/S0306-4522(00)00567-4.
RX   PUBMED; 11246162.
RA   Pearson M.M., Lu J., Mount D.B., Delpire E.;
RT   "Localization of the K(+)-Cl(-) cotransporter, KCC3, in the central and
RT   peripheral nervous systems: expression in the choroid plexus, large neurons
RT   and white matter tracts";
RL   Neuroscience 103(2):481-491(2001).
XX
RN   [2]
RP   1-6120
RX   DOI; 10.1152/ajprenal.00464.2004.
RX   PUBMED; 16048901.
RA   Mercado A., Vazquez N., Song L., Cortes R., Enck A.H., Welch R.,
RA   Delpire E., Gamba G., Mount D.B.;
RT   "NH2-terminal heterogeneity in the KCC3 K+-Cl- cotransporter";
RL   Am. J. Physiol. Renal Physiol. 289(6):F1246-F1261(2005).
XX
RN   [3]
RP   1-6120
RA   Mount D.B., Song L.S., Delpire E.;
RT   ;
RL   Submitted (03-DEC-1999) to the INSDC.
RL   Nephrology, Vanderbilt University Medical Center, S-3223 Medical Center
RL   North, VUMC, Nashville, TN 37232, USA
XX
DR   MD5; a7f09f00936da88778cc11c0fb6e92e4.
DR   Ensembl-Gn; ENSMUSG00000027130; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0026248; mus_musculus_aj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026261; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026708; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0025983; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026122; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026084; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026223; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026103; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026763; mus_musculus_nzohlltj.
DR   Ensembl-Tr; ENSMUST00000028549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053666; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0056703; mus_musculus_aj.
DR   Ensembl-Tr; MGP_BALBcJ_T0056644; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0057128; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0056304; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0056413; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0056379; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0056539; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0056355; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0057286; mus_musculus_nzohlltj.
DR   EuropePMC; PMC4460141; 26056138.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6120
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             4..3456
FT                   /codon_start=1
FT                   /product="K-Cl cotransporter 3a"
FT                   /note="KCC3a; includes alternative exon 1a; alternatively
FT                   spliced"
FT                   /db_xref="GOA:Q924N4"
FT                   /db_xref="InterPro:IPR000076"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR004842"
FT                   /db_xref="InterPro:IPR018491"
FT                   /db_xref="InterPro:IPR030364"
FT                   /db_xref="MGI:MGI:2135960"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q924N4"
FT                   /protein_id="AAK81895.1"
FT                   /translation="MHPPEATTKMSSVRFMVTPTKIDDIPGLSDTSPDLSSRSSSRVRF
FT                   SSRESVPETSRSEPMSELSGATTSLATVALDPSSDRTSNPQDVTEDPSQNSITGEHSQL
FT                   LDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGA
FT                   KEHEEAENITEGKKKPTKSPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGILQAFA
FT                   IVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAA
FT                   MYILGAIEIFLVYIVPRAAIFRSDDALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYV
FT                   NKFASLFLACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTLSSRHLDICSKTKEVDNM
FT                   TVPSKLWGFFCNSSQFFNATCDEYFVHNNVISIQGIPGLASGIITENLWSNYLPKGEII
FT                   EKPSAKSSDVLGNLNHEYVLADITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIP
FT                   IGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSPWVIVIGS
FT                   FFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKANGEPTWALLLTAAIAELGIL
FT                   IASLDLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLAL
FT                   MFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFALLRLEEGPPHTK
FT                   NWRPQLLVLLKLDEDLHVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYGDALAAEQ
FT                   TIKHLMEAEKVKGFCQLVVAAKLKEGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEDAR
FT                   AWKTFIGTVRVTTAAHLALLVAKNVSFFPSNVEQFSEGNIDVRWIVHDGGMLMLLPFLL
FT                   KQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMHDSDISAYTYE
FT                   RTLMMEQRSQMLRHMRLSKTERDREAQLVKDRNSMLRLTSIGSDEDEETETYQEKVHMT
FT                   WTKDKYMASRGQKVKSMEGFQDLLNMRPDQSNVRRMHTAVKLNEVIVNKSHEAKLVLLN
FT                   MPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS"
XX
SQ   Sequence 6120 BP; 1645 A; 1425 C; 1380 G; 1670 T; 0 other;
     aaaatgcatc caccagaagc caccaccaag atgtcctcag ttcggttcat ggtgacacca        60
     actaagattg atgacattcc aggtttgtca gacaccagcc cggacctcag ctctcggtct       120
     agttctcgag taagatttag ctcccgagaa agtgtgccag aaacaagccg tagtgagcct       180
     atgagcgaac tgtctggggc tactacttct ctggcaactg ttgccctaga tccttccagt       240
     gaccggactt ctaatcccca ggatgttacg gaggacccga gtcagaactc catcacaggg       300
     gagcacagcc agctgttaga tgacggccat aaaaaagccc gaaatgctta tctcaataat       360
     tccaactatg aagaaggaga cgaatatttt gataaaaatt tggcactctt tgaggaagaa       420
     atggacacca gaccaaaggt gtcttctctc ctcaaccgca tggccaacta tacaaatctg       480
     acacaaggag caaaggaaca tgaagaggca gagaacatca ctgaagggaa aaagaagcct       540
     accaagagcc cccaaatggg tactttcatg ggtgtctacc tcccatgtct acagaacatc       600
     tttggagtga tcctcttcct gcgtcttacc tgggtagtgg gaacagctgg aatccttcag       660
     gcctttgcaa ttgtcctcat ctgctgctgc tgtacaatgt taactgccat ctccatgagc       720
     gccatcgcca ctaacggagt ggtgccagct gggggctcat acttcatgat ttccagagcc       780
     ctgggcccag agtttggcgg ggctgtaggc ctctgctttt atcttggcac cacatttgca       840
     gcagccatgt atattcttgg tgccattgaa atctttctgg tatacattgt cccccgagct       900
     gccatctttc ggagtgacga tgcactcaag gagtcagcag ctatgctgaa caacatgcgc       960
     gtctatggta cagccttctt ggtcctcatg gtcttggtgg tattcatcgg cgtacgctat      1020
     gtgaataagt ttgcctcact cttcctggcc tgtgtaattg tgtcgatctt ggctatctat      1080
     gctggtgcca tcaagtcttc ctttgctcca ccacacttcc cggtctgtat gctgggcaac      1140
     cgtaccctgt catcaagaca ccttgacatt tgctctaaga ccaaggaggt tgacaacatg      1200
     acagtaccat caaagttatg gggattcttc tgcaactcga gtcagttctt taatgccacc      1260
     tgtgatgagt actttgttca caataacgtc atctcaatcc aaggcattcc agggttggct      1320
     agtggtatca ttactgaaaa tctttggagt aattatttac caaagggtga gataattgaa      1380
     aagccatcag ccaagtcatc tgatgtctta ggcaacttaa accatgaata tgttcttgct      1440
     gatatcacca cctccttcac tctgctggtg gggatcttct ttccctcggt cacaggtatc      1500
     atggctgggt caaacagatc tggagatctg aaagatgccc agaagtctat tcccattggg      1560
     accatccttg ccatcctgac cacatccttt gtgtatttaa gcaatgttgt cctttttggt      1620
     gcatgtattg aaggagtcgt tctcagagac aaatttgggg atgctgtaaa agggaatttg      1680
     gttgtaggca ccttatcctg gccatccccg tgggtgatcg ttattggctc cttcttttca      1740
     acatgtgggg ctgggctgca gagcctcaca ggtgcgcctc ggctgctgca ggctatcgcc      1800
     aaggataaca tcataccttt ccttagggtt tttggtcaca gcaaagctaa tggggaacct      1860
     acctgggctt tacttctaac tgctgccata gcagagctgg gaattctcat cgcctccctg      1920
     gatctcgtgg ccccaattct ttccatgttt tttctcatgt gttacctctt tgtgaacttg      1980
     gcttgtgcct tgcaaacatt gctgcgaacc cccaactgga ggcctcgatt ccgctattat      2040
     cactgggccc tctctttcat gggaatgagt atctgtctag ctctgatgtt catttcttct      2100
     tggtattatg ccattgtagc tatggtaata gctggcatga tctacaagta cattgaatat      2160
     caaggggctg agaaagaatg gggggatggt atccgtgggc tgtcgctcag tgcagcccgc      2220
     ttcgctttgc tccgtctaga ggaaggacct cctcacacta aaaactggag gcctcagctg      2280
     ctcgtcctac tgaagctgga tgaagattta cacgtcaagc accctcgcct cctcaccttt      2340
     gcctcccagc tcaaggcagg aaagggactc acgattgtgg gctctgtcat cgtggggaac      2400
     ttcttggaga actatggtga cgcgctcgcg gcagagcaga ccattaagca cctaatggag      2460
     gcagaaaagg taaaaggatt ctgccaattg gtggtggctg ccaagctgaa agagggcatt      2520
     tcacacctca tccagtcctg tggcctcgga ggcatgaaac acaacacagt ggtgatgggc      2580
     tggcccaatg gctggcgtca gagtgaagat gctcgcgctt ggaagacttt cattggcaca      2640
     gtacgagtga caactgctgc ccatctagcc ctgctggtgg ctaaaaatgt ctccttcttt      2700
     cccagcaatg tggagcagtt ttctgagggc aacattgatg tgcggtggat tgtgcatgat      2760
     gggggcatgc tcatgctatt accgttcctg ctgaaacagc acaaggtttg gcggaaatgc      2820
     agcatacgga tcttcacagt agcccaacta gaagacaaca gtatccagat gaagaaggat      2880
     ctggccacct ttctgtacca cctgcgcatt gaggcagaag tggaagtggt ggagatgcac      2940
     gacagtgaca tatctgccta tacatatgag cgcaccctga tgatggagca gaggtcccag      3000
     atgcttcggc atatgcggct gtccaaaaca gagcgagaca gggaggcaca gctggtgaaa      3060
     gatcgaaact caatgctacg cttgaccagc attggctctg atgaggacga agagacagaa      3120
     acgtaccagg agaaggtgca catgacttgg accaaggata aatacatggc atcccggggg      3180
     caaaaggtca agtcaatgga aggattccag gacctactta atatgcgtcc ggaccagtcc      3240
     aacgtgagac ggatgcatac agcagtgaag ctcaatgaag ttatagtcaa caagtctcat      3300
     gaagcaaagc tggttttgtt gaatatgcca ggaccacccc ggaaccctga aggtgatgaa      3360
     aactacatgg aatttctaga agtgctcact gagggattag aacgagtcct tcttgtccgg      3420
     ggtggtggca gtgaggtcat caccatttac tcataatcag ctgtgggaga ttctgcgtgg      3480
     tccgacttcc ctaagactca tcgtccatgg agatgatagc tctttcctac cactcccact      3540
     ctattcttgc agagctgagc cccatctatg ctcttggctg caacatgatc tgccatccca      3600
     gcagaaacaa ataatccctc aacagaagaa tggtcaagtc ctaaaagcta tttctatggc      3660
     aggagaaggc aagtcaaaat taacaagcta agccaaaggg aaccttttgg cacacagaag      3720
     gtaatgagtt agtaaaacat atgctagaaa tgtaactggc aacagaaagc aatgttcata      3780
     tctaacattc aggacgagtt tcagaagaca cgggtcagtg agcaccagaa agttaacagg      3840
     cagttaagct tcaccttagt aaaaaatgag ttcccattat agagacagcc tgcagcagcc      3900
     aggatggaaa caggatactg atatataaaa cctgagacat agctgcagcc actacttctt      3960
     cctcatggtt tattgtctgt actgtaccac tgtacatttt aactgtcttt gttttaaaac      4020
     ccattctgtg gttataatgc agacagtagt gttactatag aaatgttttt ttgaaaggct      4080
     agaaatgttt tttcaggttt tcaaatgctg aactaagggg attccaaaga gtgcgtatta      4140
     aaatatatag aaacacagtg gttagctatg caacataaag cacacaagct attatcttaa      4200
     caaatgtggg ttgttatgta gttaaccaga agggtctctt ctactcttag taggcattgg      4260
     tcttaaaaac caaacaaacc aaacctgtaa ggaagagacg ccagggctgt gtgatgccac      4320
     ctccaaggcc ccagggttca gaggttcagc agtggaactg ggggtgtgaa agccataccc      4380
     tttccactgt gccaaaatcg tctgctcact ggcagacagg tttgcaagtg gcctgacaca      4440
     agcacctttt ctttcacaag aaatccatct gtggcctctt caccaaagcc atagtgcaga      4500
     tttgaggcac tcgacctcca tgcccagagc ttttcccgtc tcaatattat tattattcat      4560
     tctgacttcg gaaacttggc tctgaaacaa atggttcact aagctaatga tctgctgtat      4620
     tggttttgct ttcaaaaagc tctaactgtg ccaaggaaat acttgtgtaa gatcagattt      4680
     tttttttttt tttaatttac tgatcacaaa cacttggctt accagcatag gcagcctttg      4740
     tggctgagca gtattcccag ggtgtgaaac ctccataccc tttccaagat agttactgaa      4800
     gaaactgtct tcttgcttag attcacggct gcttttacat ttcctttcac tgacagtaaa      4860
     ttgtgccact ctccataccc tgtaggacaa tgaacaccca gaattcaacc caagacagaa      4920
     gaaaaccctc aaatatggct taagaagctg agtcatatgg tttgttcttc ctcctcccag      4980
     gcccacttga gtagcaaagg atccagcatg ttttcctttg cttcctgcag agggtagaaa      5040
     ctactcgtag ttctctttcc aacactccat tgcatacttg agtataatcc cctaggctcc      5100
     aaggcattgg agcgcccatt ctgtaaaagc cagcctgccc aggaactgcc taacacatcc      5160
     acccctgacc aaagtgacac atactttttc catatcaaac aaacatggga agagaataag      5220
     gtttctttaa gaaaggctgt ttgtggttag agctacataa gaatctgtta aagggtagag      5280
     tatagtcttc attccccaag ataaaaatca ctgttacatg gacaaatggt tattaggcca      5340
     gatttgtact catctctgtc tagaacattt catgtctatg tgttgcttat gttgtctgtc      5400
     tgcaaagtgt cttagctctt ttaatcactg caaataaagc aatactgaaa acttgagaga      5460
     gaaaatgcac cttaggggaa ggggccaaat gtttctagag ggaagaggaa gaccttctcc      5520
     tgcctttctt ataagaccca gcttgtgtct tacccatgag tttattagca gggcaggctg      5580
     taacattcgt tctcccccaa ctggtcctca gccttccgta gctaccttaa aagctggagt      5640
     ttgaattgca gggcctggtt gacaggtgcc agcttcctcg tggcagagca aaagctgctg      5700
     cttttcatat tctgtgcctc cttttcttgt ggccccaagg atcccaccaa tcctcattcc      5760
     ccctaaatgt taaaagaaaa ttccttattg tggatattaa gttacactgt aagcatattt      5820
     acatgctctt tttcccccct ggtttttctt ttcatcatgt ataatttgaa tccagtgata      5880
     gtctcacatc ttccaaaaaa gtctgcttat gtgatataga agagaaatat taaagtagac      5940
     tgaaggggaa cttgtgaaac attaagcatt gttctcaacc gtttaattta ttgaaaggag      6000
     aagctgctac tgagcagctg ctattctttt gtttacatag agtctggttt tgtttgtttt      6060
     gctctgtgct gggaacataa ataaagtttt ctacattatt ttcaaaaaaa aaaaaaaaaa      6120
//