spacer

EBI Dbfetch

ID   AF201351; SV 1; linear; genomic DNA; STD; MUS; 696 BP.
XX
AC   AF201351;
XX
DT   11-JAN-2000 (Rel. 62, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Mus musculus glutamate receptor C gene, intron 13 and partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-696
RA   Bass B.L., Aruscavage P.J.;
RT   "A phylogenetic analysis reveals an unusual sequence conservation within
RT   introns involved in RNA editing";
RL   Unpublished.
XX
RN   [2]
RP   1-696
RA   Bass B.L., Aruscavage P.J.;
RT   ;
RL   Submitted (02-NOV-1999) to the INSDC.
RL   Biochemistry/HHMI, University of Utah, 50 N Medical Dr, Salt Lake City, UT
RL   84132, USA
XX
DR   MD5; 5703c45916e9e4767017f917734c254c.
DR   Ensembl-Gn; ENSMUSG00000001986; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000139965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165288; mus_musculus.
DR   RFAM; RF02095; mir-2985-2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..696
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             join(<1..79,636..>696)
FT                   /codon_start=3
FT                   /product="glutamate receptor C"
FT                   /note="gluR-C"
FT                   /db_xref="UniProtKB/TrEMBL:Q9QXM2"
FT                   /protein_id="AAF23963.1"
FT                   /translation="CDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKL
FT                   K"
FT   intron          80..635
FT                   /number=13
XX
SQ   Sequence 696 BP; 178 A; 126 C; 124 G; 268 T; 0 other;
     cgtgcgatac gatgaaagtt ggtggaaatc tggattccaa aggctatggt gtggcaaccc        60
     ctaaaggctc agcattaagg tgggtggaat aatataacaa tatccgtgtt gttatagtat       120
     tccacctacc ctgatgcatt ttgttgtcgt tttctttctt gtggattttg aggtaacttt       180
     taaaagttta aaatctacaa tattccatgg agttaaataa gacggtaaat tatggtttca       240
     tctatttaat gcatccattt tttttaatgt tctctctctc tgtgttgtcc tctctgactg       300
     tttgttgctg ttttaatttt acagttcaac ggctttttca atttaaatgg taaaagccaa       360
     gttatggtga cgaatgttaa ttgcatggat gtggtgttct tgttactttt tttctcaaag       420
     acaatttccc catcccgcac acttcagttt tgagcaaatg ttatcctcca tgccaccttc       480
     caatatttaa ccctgtattt gctgtacaga catttttata gctccacgtt ctgtgaaatt       540
     tagccaattt gtcctcttgt gctccttttt ttatacgtta acgatttcct aagcatttgt       600
     gcattttctt acaagttatg ttttatcgtt tcaagaaatg ctgttaacct ggcagtatta       660
     aaactgaatg agcaaggcct cttggacaaa ttgaaa                                 696
//


spacer
spacer