Dbfetch

ID   AF196282; SV 2; linear; mRNA; STD; MUS; 1718 BP.
XX
AC   AF196282;
XX
DT   16-AUG-2002 (Rel. 72, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus spermatid-specific thioredoxin (Sptrx1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1718
RX   DOI; 10.1093/molehr/8.8.710.
RX   PUBMED; 12149401.
RA   Jimenez A., Oko R., Gustafsson J.A., Spyrou G., Pelto-Huikko M.,
RA   Miranda-Vizuete A.;
RT   "Cloning, expression and characterization of mouse spermatid specific
RT   thioredoxin-1 gene and protein";
RL   Mol. Hum. Reprod. 8(8):710-718(2002).
XX
RN   [2]
RP   1-1718
RA   Miranda-Vizuete A.;
RT   ;
RL   Submitted (19-OCT-1999) to the INSDC.
RL   Center for Biotechnology, Dept. of Biosciences at Novum, Karolinska
RL   Institutet, Halsovagen 7, Huddinge S-14157, Sweden
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1718
RA   Miranda-Vizuete A.;
RT   ;
RL   Submitted (09-SEP-2002) to the INSDC.
RL   Center for Biotechnology, Dept. of Biosciences at Novum, Karolinska
RL   Institutet, Halsovagen 7, Huddinge S-14157, Sweden
XX
DR   MD5; 7dc7a2832b3f0306cff2d45b368f0b2e.
XX
CC   On Sep 9, 2002 this sequence version replaced gi:22255681.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1718
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             316..1704
FT                   /codon_start=1
FT                   /gene="Sptrx1"
FT                   /product="spermatid-specific thioredoxin"
FT                   /note="Sptrx-1"
FT                   /db_xref="GOA:Q6P902"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="MGI:MGI:2389312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6P902"
FT                   /protein_id="AAM94687.2"
FT                   /translation="MSTEESEFPQQVSSTPMFSENTVHPRHEVSPKPSSKNTQLKQENI
FT                   SKSSGYSKQTNYSNTPKSLAKTTHPKQGSTLKPATNSTHYREDDIPKSSEDIIQPKKGD
FT                   RPKSSEDIIQSKKEDRPKSSEDIIQSKKEDRPKSSEDIIQSKKEDRPKSSEDIIQSKKE
FT                   DRPKSSEDIIQPKKEDRPKSSEDSVPSKKGDRPKSSEDSVQPKKEDRPKSSEDSVQSKE
FT                   GEVHKPLKDSIQSKETKVPKSPQDSIQSKEDKTHRPLKDSVQSKESEEPKSSHESIQSK
FT                   EDKIHKPLKDSIPSKEGDIPKSPEDTIQSQEEITASEEDTIQSQEGNTIKSSEEDVQLS
FT                   ESKLLGLGAEIETLEEGLVRVIKDKEEFEEVLKDAGEKLVAVDFSAAWCGPCRMMKPLF
FT                   HSLSLKHEDVIFLEVDTEDCEQLVQDCEIFHLPTFQFYKNEEKVGEFSGALVGKLERSI
FT                   SELK"
XX
SQ   Sequence 1718 BP; 582 A; 427 C; 397 G; 312 T; 0 other;
     gcatcagctg tggagtgctg cctgagtatt aagtagttag tgtattttgt tcttagcttg        60
     gccatagaag aaatgtttaa gaaggacaaa caaaagaata aggacaaggg gctggacatg       120
     aacagtgttc aagcaggagc tcctgaagag tcggacatga cactcaacaa cggaggaaaa       180
     gcaaatgaaa ggggcagcaa cgaaaatcca ttacaggctt tatccaaaaa tgaggctttt       240
     ctggtcccag agttcttgga tacagcccag tccaaagaga aggccattgc ttccaaggtc       300
     agcaatacac ttcatatgtc cacagaagag tctgagttcc cgcagcaagt tagtagcacc       360
     cccatgtttt cagagaatac cgtccatccc agacatgaag ttagccccaa gccttcatca       420
     aaaaacactc agctgaaaca ggaaaatatt tctaaatcct cgggctactc caagcagacc       480
     aactatagca acactcccaa gtccttggca aaaaccaccc atcccaaaca ggggagcacc       540
     ctcaagcctg caacgaacag cacccattac agggaggatg acattcccaa gtcctcagaa       600
     gacatcatcc aacccaagaa aggggacagg cccaagtcct cagaagacat catccaatcc       660
     aagaaagagg acaggcccaa gtcctcagaa gacatcatcc aatccaagaa agaggacagg       720
     cccaagtcct cagaagacat catccaatcc aagaaagagg acaggcccaa gtcctcagaa       780
     gacatcatcc aatccaagaa agaggacagg cccaagtcct cagaagacat catccaaccc       840
     aagaaagagg acaggcccaa gtcctcagaa gacagcgtcc catccaagaa aggggacagg       900
     cccaagtcct cagaagacag cgtccaaccc aagaaagagg acaggcccaa gtcctcagaa       960
     gacagcgtcc aatccaagga aggtgaagtc cacaagccct taaaagacag cattcagtcc      1020
     aaggagacta aagtccctaa gtccccacag gactcaatcc agtccaaaga ggataaaacc      1080
     cacaggccct taaaggacag cgttcagtca aaggagagtg aagaacctaa gtcctcccat      1140
     gaatccatcc agtccaagga ggataaaatc cataagcctt taaaagatag catcccatct      1200
     aaggagggag atattcccaa gtccccagaa gataccatcc agtcccagga agaaatcacc      1260
     gcgtccgaag aagacaccat ccagtcccag gaaggtaaca ctatcaagtc ttcagaagaa      1320
     gatgtgcagc tctcagagag caaactctta ggccttggag cagaaataga gaccctggag      1380
     gaaggcttgg tgagagtgat caaagacaag gaggaatttg aggaggtgct caaagacgct      1440
     ggagagaagc tggtggctgt ggatttctca gccgcttggt gtggcccctg cagaatgatg      1500
     aagccactct tccattccct gtctttgaag cacgaggatg tgatattctt ggaggtggac      1560
     actgaggatt gtgagcagct ggtgcaagac tgtgagatct ttcacctccc gactttccag      1620
     ttttataaaa acgaagaaaa ggtgggtgaa ttttctggtg cccttgtggg aaaactcgaa      1680
     agaagcattt cagaattaaa gtaatcatat gttctgag                              1718
//