spacer

EBI Dbfetch

ID   AF191298; SV 2; linear; mRNA; STD; HUM; 2684 BP.
XX
AC   AF191298;
XX
DT   18-OCT-1999 (Rel. 61, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens vacuolar sorting protein 35 (VPS35) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2684
RX   DOI; 10.1006/bbrc.2000.3727.
RX   PUBMED; 11062004.
RA   Edgar A.J., Polak J.M.;
RT   "Human homologues of yeast vacuolar protein sorting 29 and 35";
RL   Biochem. Biophys. Res. Commun. 277(3):622-630(2000).
XX
RN   [2]
RP   1-2684
RA   Edgar A.J.;
RT   ;
RL   Submitted (01-OCT-1999) to the INSDC.
RL   Histochemistry, Imperial College School of Medicine, Du Cane Road, London
RL   W12 0NN, UK
XX
RN   [3]
RC   Sequence update by submitter
RP   1-2684
RA   Edgar A.J.;
RT   ;
RL   Submitted (27-APR-2000) to the INSDC.
RL   Histochemistry, Imperial College School of Medicine, Du Cane Road, London
RL   W12 0NN, UK
XX
DR   MD5; aeb6d410d8b26acd532164cf1d4ed16b.
DR   Ensembl-Gn; ENSG00000069329; homo_sapiens.
DR   Ensembl-Tr; ENST00000299138; homo_sapiens.
DR   EuropePMC; PMC1351173; 16390543.
DR   EuropePMC; PMC15060; 11102511.
XX
CC   On Apr 27, 2000 this sequence version replaced gi:6049846.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2684
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:9606"
FT   CDS             28..2418
FT                   /codon_start=1
FT                   /gene="VPS35"
FT                   /product="vacuolar sorting protein 35"
FT                   /note="similar to Mus musculus maternal-embryonic 3 encoded
FT                   by GenBank Accession Number U47024 and Saccharomyces
FT                   cerevisiae Vps35p encoded by GenBank Accession Number
FT                   S42186"
FT                   /db_xref="GOA:Q96QK1"
FT                   /db_xref="H-InvDB:HIT000073260.12"
FT                   /db_xref="HGNC:HGNC:13487"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:2R17"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96QK1"
FT                   /protein_id="AAF02778.2"
FT                   /translation="MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKH
FT                   ASNMLGELRTSMLSPKSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNI
FT                   IPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPD
FT                   EGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQGHSRDREKRERERQELRILVGT
FT                   NLVRLSQLEGVNVERYKQIVLTGILEQVVNCRDALAQEYLMECIIQVFPDEFHLQTLNP
FT                   FLRACAELHQNVNVKNIIIALIDRLALFAHREDGPGIPADIKLFDIFSQQVATVIQSRQ
FT                   DMPSEDVVSLQVSLINLAMKCYPDRVDYVDKVLETTVEIFNKLNLEHIATSSAVSKELT
FT                   RLLKIPVDTYNNILTVLKLKHFHPLFEYFDYESRKSMSCYVLSNVLDYNTEIVSQDQVD
FT                   SIMNLVSTLIQDQPDQPVEDPDPEDFADEQSLVGRFIHLLRSEDPDQQYLILNTARKHF
FT                   GAGGNQRIRFTLPPLVFAAYQLAFRYKENSKVDDKWEKKCQKIFSFAHQTISALIKAEL
FT                   AELPLRLFLQGALAAGEIGFENHETVAYEFMSQAFSLYEDEISDSKAQLAAITLIIGTF
FT                   ERMKCFSEENHEPLRTQCALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGK
FT                   RVMECLKKALKIANQCMDPSLQVQLFIEILNRYIYFYEKENDAVTIQVLNQLIQKIRED
FT                   LPNLESSEETEQINKHFHNTLEHLRLRRESPESEGPIYEGLIL"
FT   polyA_signal    2587..2592
FT                   /gene="VPS35"
XX
SQ   Sequence 2684 BP; 811 A; 536 C; 583 G; 754 T; 0 other;
     gcttgctgca ggctctgggg agtcgccatg cctacaacac agcagtcccc tcaggatgag        60
     caggaaaagc tcttggatga agccatacag gctgtgaagg tccagtcatt ccaaatgaag       120
     agatgcctgg acaaaaacaa gcttatggat gctctaaaac atgcttctaa tatgcttggt       180
     gaactccgga cttctatgtt atcaccaaag agttactatg aactttatat ggccatttct       240
     gatgaactgc actacttgga ggtctacctg acagatgagt ttgctaaagg aaggaaagtg       300
     gcagatctct acgaacttgt acagtatgct ggaaacatta tcccaaggct ttaccttttg       360
     atcacagttg gagttgtata tgtcaagtca tttcctcagt ccaggaagga tattttgaaa       420
     gatttggtag aaatgtgccg tggtgtgcaa catcccttga ggggtctgtt tcttcgaaat       480
     taccttcttc agtgtaccag aaatatctta cctgatgaag gagagccaac agatgaagaa       540
     acaactggtg acatcagtga ttccatggat tttgtactgc tcaactttgc agaaatgaac       600
     aagctctggg tgcgaatgca gcatcaggga catagccgag atagagaaaa aagagaacga       660
     gaaagacaag aactgagaat tttagtggga acaaatttgg tgcgcctaag tcagttggaa       720
     ggtgtaaatg tggaacgtta caaacagatt gttttaacag gcatattgga gcaagttgta       780
     aactgtaggg atgctttggc tcaagaatat ctcatggagt gtattattca ggttttccct       840
     gatgaatttc acctccagac tttgaatcct tttcttcggg cctgtgctga gttacaccag       900
     aatgtaaatg tgaagaacat aatcattgct ttaattgata gattagcttt atttgctcac       960
     cgtgaagatg gacctggaat cccagcggat attaaacttt ttgatatatt ttcacagcag      1020
     gtggctacag tgatacagtc tagacaagac atgccttcag aggatgttgt atctttacaa      1080
     gtctctctga ttaatcttgc catgaaatgt taccctgatc gtgtggacta tgttgataaa      1140
     gttctagaaa caacagtgga gatattcaat aagctcaacc ttgaacatat tgctaccagt      1200
     agtgcagttt caaaggaact caccagactt ttgaaaatac cagttgacac ttacaacaat      1260
     attttaacag tcttgaaatt aaaacatttt cacccactct ttgagtactt tgactacgag      1320
     tccagaaaga gcatgagttg ttatgtgctt agtaatgttc tggattataa cacagaaatt      1380
     gtctctcaag accaggtgga ttccataatg aatttggtat ccacgttgat tcaagatcag      1440
     ccagatcaac ctgtagaaga ccctgatcca gaagattttg ctgatgagca gagccttgtg      1500
     ggccgcttca ttcatctgct gcgctctgag gaccctgacc agcagtactt gattttgaac      1560
     acagcacgaa aacattttgg agctggtgga aatcagcgga ttcgcttcac actgccacct      1620
     ttggtatttg cagcttacca gctggctttt cgatataaag agaattctaa agtggatgac      1680
     aaatgggaaa agaaatgcca gaagattttt tcatttgccc accagactat cagtgctttg      1740
     atcaaagcag agctggcaga attgccctta agactttttc ttcaaggagc actagctgct      1800
     ggggaaattg gttttgaaaa tcatgagaca gtcgcatatg aattcatgtc ccaggcattt      1860
     tctctgtatg aagatgaaat cagcgattcc aaagcacagc tagctgccat caccttgatc      1920
     attggcactt ttgaaaggat gaagtgcttc agtgaagaga atcatgaacc tctgaggact      1980
     cagtgtgccc ttgctgcatc caaacttcta aagaaacctg atcagggccg agctgtgagc      2040
     acctgtgcac atctcttctg gtctggcaga aacacggaca aaaatgggga ggagcttcac      2100
     ggaggcaaga gggtaatgga gtgcctaaaa aaagctctaa aaatagcaaa tcagtgcatg      2160
     gacccctctc tacaagtgca gctttttata gaaattctga acagatatat ctatttttat      2220
     gaaaaggaaa atgatgcggt aacaattcag gttttaaacc agcttatcca aaagattcga      2280
     gaagacctcc cgaatcttga atccagtgaa gaaacagagc agattaacaa acattttcat      2340
     aacacactgg agcatttgcg cttgcggcgg gaatcaccag aatccgaggg gccaatttat      2400
     gaaggtctca tcctttaaaa aggaaatagc tcaccatact cctttccatg tacatccagt      2460
     gagggtttta ttacgctagg tttcccttcc atagattgtg cctttcagaa atgctgaggt      2520
     aggtttccca tttcttacct gtgatgtgtt ttacccagca ctccggacac tcaccttcag      2580
     gaccttaata aaattattca cttggtaagt gttcaagtct ttctgatcac cccaagtagc      2640
     atgactgatc tgcaatttaa aattcctgtg atctgtaaaa aaaa                       2684
//


spacer
spacer