spacer

EBI Dbfetch

ID   AF190665; SV 1; linear; mRNA; STD; MUS; 1473 BP.
XX
AC   AF190665;
XX
DT   02-AUG-2000 (Rel. 64, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus LMBR1 long form (Lmbr1) mRNA, complete cds, alternatively
DE   spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1473
RX   DOI; 10.1006/geno.2000.6225.
RX   PUBMED; 10945466.
RA   Clark R.M., Marker P.C., Kingsley D.M.;
RT   "A novel candidate gene for mouse and human preaxial polydactyly with
RT   altered expression in limbs of Hemimelic extra-toes mutant mice";
RL   Genomics 67(1):19-27(2000).
XX
RN   [2]
RP   1-1473
RA   Clark R.M., Marker P.C., Kingsley D.M.;
RT   ;
RL   Submitted (29-SEP-1999) to the INSDC.
RL   Department of Developmental Biology, Stanford University School of Medicine
RL   and Howard Hughes Medical Institute, Beckman Center B300--279 Campus Drive,
RL   Stanford, CA 94305-5327, USA
XX
DR   MD5; 339310cae7c49612e588809ce5528d30.
DR   Ensembl-Gn; ENSMUSG00000010721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055195; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1473
FT                   /organism="Mus musculus"
FT                   /chromosome="5"
FT                   /map="between D5Mit195 and D5Mit44"
FT                   /strain="B10.D2/nSn"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1473
FT                   /codon_start=1
FT                   /gene="Lmbr1"
FT                   /product="LMBR1 long form"
FT                   /note="LMBR1L; limb region 1"
FT                   /db_xref="GOA:Q9JIT0"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="InterPro:IPR008075"
FT                   /db_xref="MGI:MGI:1861746"
FT                   /protein_id="AAF91092.1"
FT                   /translation="MEGQDEVSAREQHFHSQVRESTICFLLFAILYIVSYFIIIRYKRK
FT                   SDEQEDEDAVVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSL
FT                   IHGLWNLASLFSNLCLFVLMPFAFFFLESEGFAGLKKGIRARILETLVMLLLLALLILG
FT                   MVWVASALIDSDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQ
FT                   LLVKPAILEDLDEQIYMITLEEEALQRRLHGLSSSVEYNVMELEQELENVKILKTKLER
FT                   RKKASAWERNLVYPAVMVLLLIETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASL
FT                   STFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSS
FT                   ALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREEL
FT                   FKALGLHKLHLSDTSRDSETTKPSANGHQKAL"
XX
SQ   Sequence 1473 BP; 360 A; 307 C; 337 G; 469 T; 0 other;
     atggaagggc aggacgaggt gtcggcgcgg gagcagcact tccacagcca agtgcgagag        60
     tccacgatat gttttcttct ctttgccatt ctctacatcg tttcctactt catcattata       120
     agatacaaga gaaaatccga tgaacaagaa gatgaggatg ctgtagtcaa caggatatcg       180
     ttgtttctga gcaccttcac tctagccgtg tcagctggcg cggttttgct tttacccttc       240
     tcaatcatca gcaatgagat cctgcttgct tttcctcaca actactatat tcagtggctg       300
     aatggctccc tcatccacgg tttgtggaat cttgcttctt tattttccaa tctttgttta       360
     tttgtgttga tgccctttgc ctttttcttt ctggaatcag aaggttttgc aggcctgaaa       420
     aagggaatcc gagcccgcat tttggaaact ctggttatgc tgctgcttct tgcgttgctg       480
     attcttggga tggtgtgggt ggcttccgcc ctgattgaca gtgatgctgc cagtatggag       540
     tctttatatg atctctggga attctacttg ccctatttgt attcttgcat ttcgctgatg       600
     ggatgcttgc tgcttctctt gtgtactcca gttggcctgt cccgtatgtt cacagtcatg       660
     ggtcagttgc tggtgaagcc agcgattctt gaagacctgg atgaacaaat ttatatgatt       720
     actctagaag aagaagcact ccagagaaga ctacatgggc tatcttcatc ggtggagtac       780
     aatgtaatgg aattggagca agaacttgag aatgtaaaga tccttaagac aaaattagag       840
     aggaggaaaa aggcttcagc ttgggagaga aatttggtgt atcctgctgt tatggttctc       900
     cttcttattg aaacatccat ttcagtcctc ctggtggcgt gcaatattct ttgcctgctg       960
     gttgatgaga ctgcaatgcc aaagggaaca aggggccccg gcataggaag tgcctctctt      1020
     tccacttttg gctttgtggg agctgcactt gaaatcattc tgattttcta tctcatggtg      1080
     tcttctgttg ttggtttcta tagcctcaga ttttttggaa actttacacc caagaaggat      1140
     gacacaacta tgacaaagat cattgggaat tgtgtgtcaa tcttagtctt gagctctgct      1200
     ttgcctgtga tgtccagaac actgggaatc actagattcg atctacttgg agactttgga      1260
     agatttaatt ggctgggaaa tttctatatt gtattatcct acaatttact cttcgccatc      1320
     atgacaacat tgtgtttgat cagaaaattc acatcagcag tacgagaaga acttttcaag      1380
     gccctaggac ttcacaaact tcacttgtca gatacctcaa gggattcaga aactacaaag      1440
     ccttctgcaa atgggcatca gaaagcactg tga                                   1473
//


spacer
spacer