Dbfetch

ID   AF189260; SV 1; linear; mRNA; STD; MUS; 2000 BP.
XX
AC   AF189260;
XX
DT   19-MAY-2000 (Rel. 63, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus GABA-A receptor theta subunit (Theta) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2000
RX   PUBMED; 10804200.
RA   Sinkkonen S.T., Hanna M.C., Kirkness E.F., Korpi E.R.;
RT   "GABA(A) receptor epsilon and theta subunits display unusual structural
RT   variation between species and are enriched in the rat locus ceruleus";
RL   J. Neurosci. 20(10):3588-3595(2000).
XX
RN   [2]
RP   1-2000
RA   Hanna M.C., Kirkness E.F.;
RT   ;
RL   Submitted (24-SEP-1999) to the INSDC.
RL   Dept. of Functional Genomics, The Institute for Genomic Research, 9712
RL   Medical Center Drive, Rockville, MD 20850, USA
XX
DR   MD5; 6d1f9b45e886a07b038d02235d53b3e2.
DR   Ensembl-Gn; ENSMUSG00000031344; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033711; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2000
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             21..1937
FT                   /codon_start=1
FT                   /gene="Theta"
FT                   /product="GABA-A receptor theta subunit"
FT                   /note="GABA-A receptor subunit family member"
FT                   /db_xref="GOA:Q9JLF1"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008101"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:1888498"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JLF1"
FT                   /protein_id="AAF70381.1"
FT                   /translation="MGIRGMLRAAALLLLIRTWLAESNGPSPTPKFHFELSSSTPEVIL
FT                   DLFNCKNCANEAVVQKILDRVLSTYDVRLRPNFGGAPVPVSVSIYVSSIEQISEINMDY
FT                   TITMFLHQTWKDTRLAYYETNLNLTLDYRMHEKLWVPDCYFVNSKDAFVHDVTVENRVF
FT                   QLHPDGTVRYGIRLTTTAACSLDLQKFPMDKQSCKLEVESYGYTVEDIVLSWEDDNAIH
FT                   ITDGLHIPQYTYLGRTITSKEVYFYTGSYMRLIVKFQVQREVRSYLVQVYWPTVLTTIL
FT                   SWISFWMNYDSSAARVTIGLTSILVLTTIDSHMRDKLPHISCIKAIDIYILVCLFFVFL
FT                   SLLEYVYINYLFFSQVPRRNHRRCRKPRRVVARYRYQEVVVANVQDGLINVEDRVEDRA
FT                   GPLPDSPMQAHLASQESLGSLVFTSEQAQLATSESLSLLSSASSQTQLATGESLSDLPS
FT                   TSEQTVPECTIHFHGFLTNDSIIPIKIHSRSDACDDEDSEESLSSEESHGHGSSHTGRL
FT                   KLQISQRCVQEASWDLDKIEILQDDISITSSWLGLDEQCKGDADSIWSLTDEELMACDQ
FT                   EKDSSSESEENCSPSPGCSFNEGFSFQLFKPNRVPKVDRWSRFLFPLSFGLFNVVYWLY
FT                   HVY"
XX
SQ   Sequence 2000 BP; 511 A; 503 C; 463 G; 523 T; 0 other;
     tccccaagag cactgcagcc atgggcatcc gaggtatgct gcgagccgct gcgctcctgc        60
     tgctcattag gacttggctg gcagagagta acggccccag tcccaccccg aaattccact       120
     tcgagctctc ctccagcacg cctgaagtca ttctggatct cttcaactgc aaaaactgtg       180
     caaatgaagc tgtggttcaa aagattttgg acagggtgct gtcaacatat gatgtccgac       240
     ttagaccaaa ttttggagga gctcctgtgc ctgtgtcagt atctatctat gtgtccagta       300
     ttgaacagat ctcagaaata aatatggact atacaatcac aatgtttttg catcagacct       360
     ggaaggacac acgcttagct tactatgaaa ccaacctaaa cctgaccctg gattatcgga       420
     tgcatgagaa gctctgggtt cctgactgct actttgtgaa tagcaaagat gcctttgtgc       480
     atgatgtaac tgtggagaat cgtgtatttc aacttcaccc agatgggaca gtgcgatatg       540
     gcatccgact taccacaaca gcagcctgtt ccctggatct gcaaaaattc cctatggaca       600
     aacaatcctg caagctggag gtggagagct atggctacac tgtcgaagac attgtgttat       660
     cctgggaaga tgataatgcc atccacatta ctgatgggct gcatatccct cagtacacgt       720
     acctggggag aacaattacc agcaaggaag tgtacttcta cacaggctcc tacatgcgcc       780
     tgatagtgaa gttccaggtt cagagggaag tccgcagtta ccttgtgcag gtctattggc       840
     ccacggtcct caccaccatt ctctcctgga tatcattttg gatgaactat gattcctctg       900
     cagccagggt aactattgga ctaacttcga tccttgtcct gactaccatc gactcacata       960
     tgcgggataa actcccccat atttcctgta tcaaagctat tgacatctac atccttgtat      1020
     gcctattctt cgttttcctg tcactgctgg agtatgtcta catcaactac cttttcttca      1080
     gccaagtacc tcggcgtaat cacagaagat gcaggaaacc caggagagtt gttgcccgat      1140
     accgctacca agaagtggtg gtagcaaatg tgcaggatgg cctgattaat gtggaagaca      1200
     gagtagaaga cagagctggt ccccttcctg acagccccat gcaggctcat ctggcaagcc      1260
     aggaaagtct aggatccttg gtgttcacat cagagcaggc ccagctggct acctcagaaa      1320
     gtctcagtct actctcttct gcctcaagcc agactcaatt ggccactgga gaaagcctga      1380
     gtgatctgcc ctccacctct gagcaaacag tgcctgagtg taccattcac tttcatggct      1440
     ttcttactaa tgacagtatt atccccatca aaatccacag ccgatctgat gcctgtgatg      1500
     atgaagactc cgaagaaagc ctaagctctg aggagagcca tggccatgga agcagccaca      1560
     ctggaaggct caagctccag attagccaga ggtgtgtgca agaagcaagt tgggaccttg      1620
     ataaaattga gatcttacag gatgacatca gtatcacgag cagctggctt ggccttgatg      1680
     aacaatgcaa gggggatgct gacagtatct ggagccttac tgatgaggag ctcatggcct      1740
     gtgaccaaga gaaggacagt agctcagagt ctgaggagaa ttgctcccca agccctgggt      1800
     gctccttcaa tgaagggttc tcttttcagc tctttaaacc taaccgggtc cccaaggttg      1860
     atagatggtc ccgtttcctc tttcctcttt cctttgggct gttcaatgtg gtttactggt      1920
     tataccatgt ctattagttt ctcatacacc acagccgcgg agatactatg atatgtttcc      1980
     tttatggttt cttcgggttt                                                  2000
//