Dbfetch

ID   AF186382; SV 1; linear; mRNA; STD; HUM; 3208 BP.
XX
AC   AF186382;
XX
DT   18-DEC-2000 (Rel. 66, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens vacuolar protein sorting 35 mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3208
RX   DOI; 10.1006/geno.2000.6380.
RX   PUBMED; 11112353.
RA   Zhang P., Yu L., Gao J., Fu Q., Dai F., Zhao Y., Zheng L., Zhao S.;
RT   "Cloning and characterization of human VPS35 and mouse Vps35 and mapping of
RT   VPS35 to human chromosome 16q13-q21";
RL   Genomics 70(2):253-257(2000).
XX
RN   [2]
RP   1-3208
RA   Yu L.;
RT   ;
RL   Submitted (14-SEP-1999) to the INSDC.
RL   Lab of Human Gene Research, Institute of Genetics, Fudan University, No.
RL   220 Handan Rd., Shanghai 200433, P.R.China
XX
DR   MD5; d549bb9ae37ec12660a44d7c668f95b2.
DR   Ensembl-Gn; ENSG00000069329; homo_sapiens.
DR   Ensembl-Tr; ENST00000299138; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3208
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             54..2444
FT                   /codon_start=1
FT                   /product="vacuolar protein sorting 35"
FT                   /note="VPS35"
FT                   /db_xref="GOA:Q96QK1"
FT                   /db_xref="H-InvDB:HIT000072918.13"
FT                   /db_xref="HGNC:HGNC:13487"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:2R17"
FT                   /db_xref="PDB:5F0J"
FT                   /db_xref="PDB:5F0K"
FT                   /db_xref="PDB:5F0L"
FT                   /db_xref="PDB:5F0M"
FT                   /db_xref="PDB:5F0P"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96QK1"
FT                   /protein_id="AAG40619.1"
FT                   /translation="MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKH
FT                   ASNMLGELRTSMLSPKSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNI
FT                   IPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPD
FT                   EGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQGHSRDREKRERERQELRILVGT
FT                   NLVRLSQLEGVNVERYKQIVLTGILEQVVNCRDALAQEYLMECIIQVFPDEFHLQTLNP
FT                   FLRACAELHQNVNVKNIIIALIDRLALFAHREDGPGIPADIKLFDIFSQQVATVIQSRQ
FT                   DMPSEDVVSLQVSLINLAMKCYPDRVDYVDKVLETTVEIFNKLNLEHIATSSAVSKELT
FT                   RLLKIPVDTYNNILTVLKLKHFHPLFEYFDYESRKSMSCYVLSNVLDYNTEIVSQDQVD
FT                   SIMNLVSTLIQDQPDQPVEDPDPEDFADEQSLVGRFIHLLRSEDPDQQYLILNTARKHF
FT                   GAGGNQRIRFTLPPLVFAAYQLAFRYKENSKVDDKWEKKCQKIFSFAHQTISALIKAEL
FT                   AELPLRLFLQGALAAGEIGFENHETVAYEFMSQAFSLYEDEISDSKAQLAAITLIIGTF
FT                   ERMKCFSEENHEPLRTQCALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGK
FT                   RVMECLKKALKIANQCMDPSLQVQLFIEILNRYIYFYEKENDAVTIQVLNQLIQKIRED
FT                   LPNLESSEETEQINKHFHNTLEHLRLRRESPESEGPIYEGLIL"
FT   regulatory      2613..2618
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 3208 BP; 959 A; 623 C; 679 G; 947 T; 0 other;
     ggctatggac gcgcggggcg ggtgctgctt gctgcaggct ctggggagtc gccatgccta        60
     caacacagca gtcccctcag gatgagcagg aaaagctctt ggatgaagcc atacaggctg       120
     tgaaggtcca gtcattccaa atgaagagat gcctggacaa aaacaagctt atggatgctc       180
     taaaacatgc ttctaatatg cttggtgaac tccggacttc tatgttatca ccaaagagtt       240
     actatgaact ttatatggcc atttctgatg aactgcacta cttggaggtc tacctgacag       300
     atgagtttgc taaaggaagg aaagtggcag atctctacga acttgtacag tatgctggaa       360
     acattatccc aaggctttac cttttgatca cagttggagt tgtatatgtc aagtcatttc       420
     ctcagtccag gaaggatatt ttgaaagatt tggtagaaat gtgccgtggt gtgcaacatc       480
     ccttgagggg tctgtttctt cgaaattacc ttcttcagtg taccagaaat atcttacctg       540
     atgaaggaga gccaacagat gaagaaacaa ctggtgacat cagtgattcc atggattttg       600
     tactgctcaa ctttgcagaa atgaacaagc tctgggtgcg aatgcagcat cagggacata       660
     gccgagatag agaaaaaaga gaacgagaaa gacaagaact gagaatttta gtgggaacaa       720
     atttggtgcg cctcagtcag ttggaaggtg taaatgtgga acgttacaaa cagattgttt       780
     tgactggcat attggagcaa gttgtaaact gtagggatgc tttggctcaa gaatatctca       840
     tggagtgtat tattcaggtt ttccctgatg aatttcacct ccagactttg aatccttttc       900
     ttcgggcctg tgctgagtta caccagaatg taaatgtgaa gaacataatc attgctttaa       960
     ttgatagatt agctttattt gctcaccgtg aagatggacc tggaatccca gcggatatta      1020
     aactttttga tatattttca cagcaggtgg ctacagtgat acagtctaga caagacatgc      1080
     cttcagagga tgttgtatct ttacaagtct ctctgattaa tcttgccatg aaatgttacc      1140
     ctgatcgtgt ggactatgtt gataaagttc tagaaacaac agtggagata ttcaataagc      1200
     tcaaccttga acatattgct accagtagtg cagtttcaaa ggaactcacc agacttttga      1260
     aaataccagt tgacacttac aacaatattt taacagtctt gaaattaaaa cattttcacc      1320
     cactctttga gtactttgac tacgagtcca gaaagagcat gagttgttat gtgcttagta      1380
     atgttctgga ttataacaca gaaattgtct ctcaagacca ggtggattcc ataatgaatt      1440
     tggtatccac gttgattcaa gatcagccag atcaacctgt agaagaccct gatccagaag      1500
     attttgctga tgagcagagc cttgtgggcc gcttcattca tctgctgcgc tctgaggacc      1560
     ctgaccagca gtacttgatt ttgaacacag cacgaaaaca ttttggagct ggtggaaatc      1620
     agcggattcg cttcacactg ccacctttgg tatttgcagc ttaccagctg gcttttcgat      1680
     ataaagagaa ttctaaagtg gatgacaaat gggaaaagaa atgccagaag attttttcat      1740
     ttgcccacca gactatcagt gctttgatca aagcagagct ggcagaattg cccttaagac      1800
     tttttcttca aggagcacta gctgctgggg aaattggttt tgaaaatcat gagacagtcg      1860
     catatgaatt catgtcccag gcattttctc tgtatgaaga tgaaatcagc gattccaaag      1920
     cacagctagc tgccatcacc ttgatcattg gcacttttga aaggatgaag tgcttcagtg      1980
     aagagaatca tgaacctctg aggactcagt gtgcccttgc tgcatccaaa cttctaaaga      2040
     aacctgatca gggccgagct gtgagcacct gtgcacatct cttctggtct ggcagaaaca      2100
     cggacaaaaa tggggaggag cttcacggag gcaagagggt aatggagtgc ctaaaaaaag      2160
     ctctaaaaat agcaaatcag tgcatggacc cctctctaca agtgcagctt tttatagaaa      2220
     ttctgaacag atatatctat ttttatgaaa aggaaaatga tgcggtaaca attcaggttt      2280
     taaaccagct tatccaaaag attcgagaag acctcccgaa tcttgaatcc agtgaagaaa      2340
     cagagcagat taacaaacat tttcataaca cactggagca tttgcgcttg cggcgggaat      2400
     caccagaatc cgaggggcca atttatgaag gtctcatcct ttaaaaagga aatagctcac      2460
     catactcctt tccatgtaca tccagtgagg gttttattac gctaggtttc ccttccatag      2520
     attgtgcctt tcagaaatgc tgaggtaggt ttcccatttc ttacctgtga tgtgttttac      2580
     ccagcactcc ggacactcac cttcaggacc ttaataaaat tattcacttg gtaagtgttc      2640
     aagtctttct gatcacccca agtagcatga ctgatctgca atttaaaatt cctgtgatct      2700
     gtagcactta tcttggctac taatgaagct ctcctttttt ttgtttgttt gtttgcttca      2760
     ttgttgattg tgtattttct tcattcctgg ggagtactaa cccaaaagcg tctgtctctt      2820
     gttttctagt ccagtttgag attaatttag aagaaaggaa tactgtatgt gaaattcatc      2880
     ttgggctttc ccctaaattg caagataagg ccatgtgtaa gattttccct aaaactagaa      2940
     tatattaatg catgtttgag aattttaaag caccatggtc aaaaccagaa gctatatttt      3000
     gcatatttgg actcagccat ccattaagaa cccatgttgt cctctggaca tatttatcaa      3060
     tataattggg ttttaaatag tataaaagaa aacttgtgat ctatataatt tatgtatcac      3120
     cttcattgta aatttagcag gaaatgcatc acaattatga tttttttttt tgcaccagtg      3180
     aaacaataaa gatgctatta acaaaaaa                                         3208
//