spacer

EBI Dbfetch

ID   AF183418; SV 1; linear; mRNA; STD; HUM; 2688 BP.
XX
AC   AF183418;
XX
DT   05-SEP-2000 (Rel. 65, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens maternal-embryonic 3 mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2688
RA   Peng Y., Li Y., Tu Y., Xu S., Han Z., Fu G., Chen Z.;
RT   "A novel gene expressed in human pheochromocytoma";
RL   Unpublished.
XX
RN   [2]
RP   1-2688
RA   Peng Y., GU W., Huang C., Xu S., Han Z., Fu G., Chen Z.;
RT   ;
RL   Submitted (03-SEP-1999) to the INSDC.
RL   Chinese National Human Genome Center at Shanghai, 351 Guo Shoujing Road,
RL   Zhangjiang Hi-Tech Park, Pudong, Shanghai 201203, P. R. China
XX
DR   MD5; 9d54eefa0effb0a2f90afe993ce51237.
DR   Ensembl-Gn; ENSG00000069329; homo_sapiens.
DR   Ensembl-Tr; ENST00000299138; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2688
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="pheochromocytoma"
FT                   /db_xref="taxon:9606"
FT   CDS             9..2399
FT                   /codon_start=1
FT                   /product="maternal-embryonic 3"
FT                   /note="MEM3"
FT                   /db_xref="GOA:Q96QK1"
FT                   /db_xref="H-InvDB:HIT000002205.15"
FT                   /db_xref="HGNC:HGNC:13487"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:2R17"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96QK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAG09687.1"
FT                   /translation="MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKH
FT                   ASNMLGELRTSMLSPKSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNI
FT                   IPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPD
FT                   EGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQGHSRDREKRERERQELRILVGT
FT                   NLVRLSQLEGVNVERYKQIVLTGILEQVVNCRDALAQEYLMECIIQVFPDEFHLQTLNP
FT                   FLRACAELHQNVNVKNIIIALIDRLALFAHREDGPGIPADIKLFDIFSQQVATVIQSRQ
FT                   DMPSEDVVSLQVSLINLAMKCYPDRVDYVDKVLETTVEIFNKLNLEHIATSSAVSKELT
FT                   RLLKIPVDTYNNILTVLKLKHFHPLFEYFDYESRKSMSCYVLSNVLDYNTEIVSQDQVD
FT                   SIMNLVSTLIQDQPDQPVEDPDPEDFADEQSLVGRFIHLLRSEDPDQQYLILNTARKHF
FT                   GAGGNQRIRFTLPPLVFAAYQLAFRYKENSKVDDKWEKKCQKIFSFAHQTISALIKAEL
FT                   AELPLRLFLQGALAAGEIGFENHETVAYEFMSQAFSLYEDEISDSKAQLAAITLIIGTF
FT                   ERMKCFSEENHEPLRTQCALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGK
FT                   RVMECLKKALKIANQCMDPSLQVQLFIEILNRYIYFYEKENDAVTIQVLNQLIQKIRED
FT                   LPNLESSEETEQINKHFHNTLEHLRLRRESPESEGPIYEGLIL"
XX
SQ   Sequence 2688 BP; 829 A; 533 C; 576 G; 750 T; 0 other;
     gagtcgccat gcctacaaca cagcagtccc ctcaggatga gcaggaaaag ctcttggatg        60
     aagccataca ggctgtgaag gtccagtcat tccaaatgaa gagatgcctg gacaaaaaca       120
     agcttatgga tgctctaaaa catgcttcta atatgcttgg tgaactccgg acttctatgt       180
     tatcaccaaa gagttactat gaactttata tggccatttc tgatgaactg cactacttgg       240
     aggtctacct gacagatgag tttgctaaag gaaggaaagt ggcagatctc tacgaacttg       300
     tacagtatgc tggaaacatt atcccaaggc tttacctttt gatcacagtt ggagttgtat       360
     atgtcaagtc atttcctcag tccaggaagg atattttgaa agatttggta gaaatgtgcc       420
     gtggtgtgca acatcccttg aggggtctgt ttcttcgaaa ttaccttctt cagtgtacca       480
     gaaatatctt acctgatgaa ggagagccaa cagatgaaga aacaactggt gacatcagtg       540
     attccatgga ttttgtactg ctcaactttg cagaaatgaa caagctctgg gtgcgaatgc       600
     agcatcaggg acatagccga gatagagaaa aaagagaacg agaaagacaa gaactgagaa       660
     ttttagtggg aacaaatttg gtgcgcctca gtcagttgga aggtgtaaat gtggaacgtt       720
     acaaacagat tgttttgact ggcatattgg agcaagttgt aaactgtagg gatgctttgg       780
     ctcaagaata tctcatggag tgtattattc aggttttccc tgatgaattt cacctccaga       840
     ctttgaatcc ttttcttcgg gcctgtgctg agttacacca gaatgtaaat gtgaagaaca       900
     taatcattgc tttaattgat agattagctt tatttgctca ccgtgaagat ggacctggaa       960
     tcccagcgga tattaaactt tttgatatat tttcacagca ggtggctaca gtgatacagt      1020
     ctagacaaga catgccttca gaggatgttg tatctttaca agtctctctg attaatcttg      1080
     ccatgaaatg ttaccctgat cgtgtggact atgttgataa agttctagaa acaacagtgg      1140
     agatattcaa taagctcaac cttgaacata ttgctaccag tagtgcagtt tcaaaggaac      1200
     tcaccagact tttgaaaata ccagttgaca cttacaacaa tattttaaca gtcttgaaat      1260
     taaaacattt tcacccactc tttgagtact ttgactacga gtccagaaag agcatgagtt      1320
     gttatgtgct tagtaatgtt ctggattata acacagaaat tgtctctcaa gaccaggtgg      1380
     attccataat gaatttggta tccacgttga ttcaagatca gccagatcaa cctgtagaag      1440
     accctgatcc agaagatttt gctgatgagc agagccttgt gggccgcttc attcatctgc      1500
     tgcgctctga ggaccctgac cagcagtact tgattttgaa cacagcacga aaacattttg      1560
     gagctggtgg aaatcagcgg attcgcttca cactgccacc tttggtattt gcagcttacc      1620
     agctggcttt tcgatataaa gagaattcta aagtggatga caaatgggaa aagaaatgcc      1680
     agaagatttt ttcatttgcc caccagacta tcagtgcttt gatcaaagca gagctggcag      1740
     aattgccctt aagacttttt cttcaaggag cactagctgc tggggaaatt ggttttgaaa      1800
     atcatgagac agtcgcatat gaattcatgt cccaggcatt ttctctgtat gaagatgaaa      1860
     tcagcgattc caaagcacag ctagctgcca tcaccttgat cattggcact tttgaaagga      1920
     tgaagtgctt cagtgaagag aatcatgaac ctctgaggac tcagtgtgcc cttgctgcat      1980
     ccaaacttct aaagaaacct gatcagggcc gagctgtgag cacctgtgca catctcttct      2040
     ggtctggcag aaacacggac aaaaatgggg aggagcttca cggaggcaag agggtaatgg      2100
     agtgcctaaa aaaagctcta aaaatagcaa atcagtgcat ggacccctct ctacaagtgc      2160
     agctttttat agaaattctg aacagatata tctattttta tgaaaaggaa aatgatgcgg      2220
     taacaattca ggttttaaac cagcttatcc aaaagattcg agaagacctc ccgaatcttg      2280
     aatccagtga agaaacagag cagattaaca aacattttca taacacactg gagcatttgc      2340
     gcttgcggcg ggaatcacca gaatccgagg ggccaattta tgaaggtctc atcctttaaa      2400
     aaggaaatag ctcaccatac tcctttccat gtacatccag tgagggtttt attacgctag      2460
     gtttcccttc catagattgt gcctttcaga aatgctgagg taggtttccc atttcttacc      2520
     tgtgatgtgt tttacccagc acctccggac actcaccttc aggaccttaa taaaattatt      2580
     cacttggtaa gtgttcaagt ctttctgatc accccaagta gcatgactga tctgcaattt      2640
     aaaattcctg tgatctgtaa aaaaaaaaaa aaaaaaaaaa aaaaaaaa                   2688
//


spacer
spacer