Dbfetch

ID   AF182033; SV 1; linear; mRNA; STD; MUS; 2486 BP.
XX
AC   AF182033;
XX
DT   27-APR-2000 (Rel. 63, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus polycystic kidney disease-like 2 protein (Pkdl2) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2486
RX   DOI; 10.1006/geno.2000.6131.
RX   PUBMED; 10756092.
RA   Guo L., Schreiber T.H., Weremowicz S., Morton C.C., Lee C., Zhou J.;
RT   "Identification and characterization of a novel polycystin family member,
RT   polycystin-L2, in mouse and human: sequence, expression, alternative
RT   splicing, and chromosomal localization";
RL   Genomics 64(3):241-251(2000).
XX
RN   [2]
RP   1-2486
RA   Guo L., Zhou J.;
RT   ;
RL   Submitted (31-AUG-1999) to the INSDC.
RL   Renal Division, Department of Medicine, Brigham and Women's Hospital,
RL   Harvard Medical School, 77 Louis Pasteur Ave., HIM 520, Boston, MA 02115,
RL   USA
XX
DR   MD5; af82f3e7e99204bdfd16313914191516.
DR   Ensembl-Gn; ENSMUSG00000014503; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024239; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024205; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024174; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024205; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023973; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024647; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023448; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023941; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024073; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024039; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024154; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024067; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024695; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023191; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023511; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000014647; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166156; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049220; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0049200; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0049161; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049161; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048905; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049651; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049000; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0048829; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0048938; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0048899; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0049051; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048901; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049756; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048597; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048203; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2486
FT                   /organism="Mus musculus"
FT                   /chromosome="18"
FT                   /map="band C"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             45..1910
FT                   /codon_start=1
FT                   /gene="Pkdl2"
FT                   /product="polycystic kidney disease-like 2 protein"
FT                   /note="PcL2; polycystin-like 2 protein"
FT                   /db_xref="GOA:Q9JLG4"
FT                   /db_xref="InterPro:IPR003915"
FT                   /db_xref="InterPro:IPR013122"
FT                   /db_xref="MGI:MGI:1858231"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JLG4"
FT                   /protein_id="AAF65621.1"
FT                   /translation="MSEATWWYRGGTSKHDLHYRREAEVNTTLEELLLYFIFLINLCIL
FT                   TFGMVNPHMYYLNKVMSSLFVDTSLPDDERSSFRSIRSITEFWKFMEGPLIDGLYWDSW
FT                   YGTKQLYSVKNSSRIYYENVLLGIPRVRQLRVRNNTCKVYPAFQSLVSDCYSKYTVENE
FT                   DFSDFGLKRNPEWTHTPSSRTAPWHWGFVGVYRDGGYIVTLSKSKSETKAKFVDLRLNN
FT                   WISRGTRAVFIDFSLYNANVNLFCIIRLLAEFPATGGLLTSWQFYSVKLLRYVSYYDYF
FT                   IASCEVIFCIFLFVFIIQELRKVNEFKSAYFRSVWNWLEMLLLLLCFLAVSFYAYCNMQ
FT                   SFLLLGQLLKNTDSYPDFYFLAYWHIYYNNVIAITIFFAWIKIFKFISFNETMSQLSST
FT                   LSRCMKDIVGFAIMFFIIFSAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAG
FT                   IQQANWILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRPDFELGKIIQK
FT                   SCFNVLEKLRLKKAQAKEEKKMQTTDLAQRARREGFDESEIQEAEQMKRWKERLEKKYY
FT                   STEIQDDYQPVTQQEFRELFLYAVELEKELHYVSLKLNQLMRKLH"
XX
SQ   Sequence 2486 BP; 717 A; 536 C; 537 G; 696 T; 0 other;
     ggcagaacgg gcatagtgga acggaccgtg tggtatgctc cgcgatgtct gaggcgactt        60
     ggtggtaccg aggagggact tcaaaacatg acctgcatta cagaagggaa gcggaggtta       120
     acaccacact cgaggagttg ttactctatt ttattttctt aataaatcta tgcatattga       180
     cttttgggat ggtcaatcca catatgtact atttaaacaa agttatgtcg tctctgtttg       240
     tggacacttc tctacctgat gatgaaagaa gcagctttag gtccattcgg agcataactg       300
     agttttggaa gttcatggaa ggacccctca tcgacggctt gtactgggac tcgtggtatg       360
     gcaccaaaca gctgtacagt gtgaagaaca gcagccgcat ctactacgag aacgttcttc       420
     tcggcatccc cagagtgcgg caactgcgag tccgaaacaa cacttgcaag gtctacccag       480
     ctttccagtc cctggtcagc gactgctaca gcaagtacac agtggaaaac gaagacttct       540
     ctgattttgg cctcaaacgc aatccagaat ggacgcacac gccttcttcc cgcactgccc       600
     catggcactg ggggtttgtt ggcgtatacc gagatggagg atatatagtc acgttatcaa       660
     aatcaaaatc tgaaaccaaa gccaaatttg ttgaccttcg actgaacaac tggattagca       720
     gaggcaccag ggctgttttt attgatttct ccctgtacaa tgctaatgtc aacctgtttt       780
     gcatcatcag gctgctggca gagttccctg cgacgggtgg gctcctcacc tcctggcagt       840
     tctactctgt gaagctcctc agatacgtct cctactacga ctacttcatt gcctcctgtg       900
     aagtcatatt ttgtattttt ctctttgtct tcataataca agaactgagg aaagtgaacg       960
     agtttaagtc tgcctatttc agaagtgtct ggaactggct ggagatgctg ctcctgctgc      1020
     tctgttttct cgccgtgtct ttctatgcat actgtaacat gcagagcttt ctcttgcttg      1080
     gacagctgct gaaaaacact gacagctatc ccgactttta cttccttgca tactggcaca      1140
     tttactataa caacgtaatt gctatcacta tcttctttgc atggataaag atattcaagt      1200
     tcataagctt caatgagaca atgtcgcagc tgtcatcaac actctcccgc tgcatgaagg      1260
     acatcgtggg gttcgccatc atgttcttca tcatcttctc tgcttatgcc cagttgggat      1320
     ttctggtttt tgggtcacag gttgatgatt tttcaacttt tcaaaattcc atatttgcac      1380
     aatttcgaat tgtcctcggg gactttaact ttgctggcat ccagcaggcc aactggatct      1440
     tggggcccat ctacttcatc acgttcatct tctttgtgtt ctttgtgctc ctgaacatgt      1500
     tcttggcaat aattaatgac acctattctg aagttaaggc tgattattca ataggcagaa      1560
     gaccagattt tgaacttggt aaaataattc aaaagagttg ctttaatgtt ctcgagaaac      1620
     tcagactcaa gaaagctcaa gctaaagaag aaaagaaaat gcaaaccact gacttggccc      1680
     agagagccag aagagaaggc tttgatgaaa gtgagatcca agaggcagag cagatgaaaa      1740
     gatggaagga aaggcttgaa aaaaagtatt attctacaga aattcaagac gattatcagc      1800
     ctgtcactca gcaagaattc cgagagctct ttttatacgc ggtggagctt gagaaggaat      1860
     tacactatgt cagtttaaaa ctgaaccaac tgatgagaaa gctgcactag caggctgaca      1920
     agtggagtca ttttataaga aaaggcaacc gaagaatttc attcagtatg aagatttttt      1980
     cctctcaatt ttcttcagta atgcaaaaga aaaaccaaaa agtaaccaga agtgcttttt      2040
     atttcaaagt tcttgaagta aaagagtaaa actcttgtcc tttgctaaca gccgtgtctg      2100
     cagtaaaaca atgaaggagc ctgcgtgttt cctaagtgtg gagaggatct gcgggaatgt      2160
     ggaacagctt tccttgccta ctggaaccac aaacaagcac acaatgggac tctctgagtg      2220
     cctgacaaag tgaacgcaag tacagccaag cacacatggt gaactgtcag ggaacacaag      2280
     cactttatgg cgtcaacttt caaggaacat attttatatg gattttgaag agtcttgttt      2340
     gctgataaga acttcaagaa gtctaagctt ggctttgatt ctcttgtatt ccttatattc      2400
     ctcaagcacc ggaacacgat cctccttctg ggcattccta gggaagataa aactctgtaa      2460
     agcaaaaaaa agaaaaaaaa aaaaaa                                           2486
//