spacer

EBI Dbfetch

ID   AF177215; SV 1; linear; genomic DNA; STD; HUM; 266 BP.
XX
AC   AF177215;
XX
DT   07-SEP-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class II antigen DRB1 (HLA-DRB1) gene, HLA-DRB1*SDAV
DE   allele, exon 2; and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-266
RX   DOI; 10.1046/j.1365-2370.2001.00243.x.
RX   PUBMED; 11532019.
RA   Trejaut J., Kennedy A., Hobart D., Le T., Greville W.D., Ng G.,
RA   Taverniti A., Dunckley H.;
RT   "PCR-RFLP typing detects new HLA-DRB1 alleles: DRB1*13022, DRB1*1336 and
RT   DRB1*1435";
RL   Eur. J. Immunogenet. 28(4):441-447(2001).
XX
RN   [2]
RP   1-266
RA   Greville W.D., Ng G., Kennedy A., Dunckley H.;
RT   "New HLA class II (DRB1) allele detected by sequencing-based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-266
RA   Greville W.D., Ng G., Kennedy A., Dunckley H.;
RT   ;
RL   Submitted (11-AUG-1999) to the INSDC.
RL   Tissue Typing Department, Molecular Genetics Laboratory, Australian Red
RL   Cross Blood Service, 153 Clarence Street, Sydney, NSW 2000, Australia
XX
DR   MD5; 099477d80109652b0f30a977700b3dc0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..266
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="SDAV"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>266
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen DRB1"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:35"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="AAD53910.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEFRAV
FT                   TELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQR"
FT   exon            1..266
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 266 BP; 52 A; 64 C; 98 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgctgc ggagcactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcgg                                            266
//


spacer
spacer