spacer

EBI Dbfetch

ID   AF177144; SV 1; linear; mRNA; STD; MUS; 1302 BP.
XX
AC   AF177144;
XX
DT   12-DEC-1999 (Rel. 62, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus mammalian inositol hexakisphosphate kinase 1 (Ip6k1) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1302
RX   DOI; 10.1016/S0960-9822(00)80055-X.
RX   PUBMED; 10574768.
RA   Saiardi A., Erdjument-Bromage H., Snowman A.M., Tempst P., Snyder S.H.;
RT   "Synthesis of diphosphoinositol pentakisphosphate by a newly identified
RT   family of higher inositol polyphosphate kinases";
RL   Curr Biol 9(22):1323-1326(1999).
XX
RN   [2]
RP   1-1302
RA   Saiardi A., Erdjument-Bromage H., Snowman A.M., Tempst P., Snyder S.H.;
RT   ;
RL   Submitted (11-AUG-1999) to the INSDC.
RL   Neuroscience, John Hopkins University, 725 N. Wolfe St., Baltimore, MD
RL   21205, USA
XX
DR   MD5; e61998c5d47eb41b249ed9c863e67dcc.
DR   Ensembl-Gn; ENSMUSG00000032594; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035214; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1302
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1302
FT                   /codon_start=1
FT                   /gene="Ip6k1"
FT                   /product="mammalian inositol hexakisphosphate kinase 1"
FT                   /note="MIP6K1"
FT                   /db_xref="GOA:Q6PD10"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="MGI:MGI:1351633"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6PD10"
FT                   /protein_id="AAF15056.1"
FT                   /translation="MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDH
FT                   TVCKPLISREQRFYESLPPEMKEFTPEYKGVVSVCFEGDSDGYINLVAYPYVESETVEQ
FT                   DDTPEREQPRRKHSRRSLHRSGSGSDHKEEKASLSFETSESSQEAKSPKVELHSHSDVP
FT                   FQMLDSNSGLSSEKISYNPWSLRCHKQQLSRMRSESKDRKLYKFLLLENVVHHFKYPCV
FT                   LDLKMGTRQHGDDASAEKAARQMRKCEQSTSATLGVRVCGMQVYQLDTGHYLCRNKYYG
FT                   RGLSIEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYD
FT                   GKECRSELRLKHVDMGLPEVPPPCGPSTSPSSTSLEAGPSSPPKVDVRMIDFAHSTFKG
FT                   FRDDPTVHDGPDRGYVFGLENLISIMEQVPDENQ"
XX
SQ   Sequence 1302 BP; 303 A; 364 C; 372 G; 263 T; 0 other;
     atgtgtgttt gtcaaaccat ggaagtgggg cagtatggca agaacgcaag tcgggccgga        60
     gaccgaggag tcctcctgga gcccttcatc catcaggtgg gcgggcacag cagcatgatg       120
     cggtacgacg accacactgt gtgcaaacct ctcatctccc gggaacagcg cttctacgag       180
     tcactccctc ccgaaatgaa ggaattcacc ccagagtaca aaggcgtggt ttctgtctgt       240
     tttgagggag acagtgatgg ttacatcaac ttggtagcct atccttatgt ggagagtgaa       300
     actgtagagc aagatgacac accagagcgg gagcaacctc ggcgcaaaca ctcccgccgg       360
     agcctgcatc ggtctggcag tggtagtgac cacaaggagg agaaagccag cctgtccttt       420
     gagacctctg agagctccca ggaggcaaag agtccaaagg tggaactgca cagccactca       480
     gatgtccctt tccagatgct agacagcaat agcggtctga gctccgagaa gatcagctac       540
     aacccctgga gcctgcgctg ccacaagcag cagctgagcc gcatgcgctc cgagtccaag       600
     gaccgaaaac tctacaagtt cctcctgctt gagaacgtgg tacaccactt caagtacccc       660
     tgtgtgctgg acttgaagat gggtacccgg cagcatggcg atgatgcttc agctgaaaag       720
     gctgcccggc agatgaggaa gtgtgagcag agcacgtcgg ccacgctggg ggtcagggtc       780
     tgtggcatgc aggtgtacca gctggacaca ggtcattacc tctgcaggaa taagtactat       840
     ggccgtggac tctccatcga gggcttccgc aatgcgctct atcagtacct gcacaatggc       900
     ttggaccttc gacgtgacct ttttgagcca atcctgagca aactgcgggg cctcaaagcc       960
     gtactggagc ggcaggcctc ctaccgcttc tactccagct ccctgcttgt catctatgat      1020
     ggcaaggagt gccggtctga gctacgtctc aagcacgtgg acatggggct ccctgaggtg      1080
     ccaccaccct gtggccccag caccagtcct agcagcacca gtcttgaggc tggcccctct      1140
     tctccgccca aggtggatgt tcgcatgatt gactttgcac acagcacatt caagggcttc      1200
     cgggatgacc ccactgttca cgatgggcca gacagaggct atgtgtttgg cttggagaat      1260
     cttatcagca tcatggagca ggtgccggat gagaaccagt ag                         1302
//


spacer
spacer