Dbfetch

ID   AF176906; SV 1; linear; mRNA; STD; MUS; 1405 BP.
XX
AC   AF176906;
XX
DT   23-SEP-1999 (Rel. 61, Created)
DT   26-DEC-1999 (Rel. 62, Last updated, Version 2)
XX
DE   Mus musculus sprouty 4 (Spry4) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1405
RX   PUBMED; 10498682.
RA   Minowada G., Jarvis L.A., Chi C.L., Neubuser A., Sun X., Hacohen N.,
RA   Krasnow M.A., Martin G.R.;
RT   "Vertebrate Sprouty genes are induced by FGF signaling and can cause
RT   chondrodysplasia when overexpressed";
RL   Development 126(20):4465-4475(1999).
XX
RN   [2]
RP   1-1405
RA   Minowada G., Martin G.R.;
RT   ;
RL   Submitted (11-AUG-1999) to the INSDC.
RL   Anatomy, University of California, San Francisco, 513 Parnassus, San
RL   Francisco, CA 94143, USA
XX
DR   MD5; a8fa73c5da72dcb0509afb613dc749e2.
DR   Ensembl-Gn; ENSMUSG00000024427; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024365; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024332; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024301; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024332; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024098; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024774; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023573; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024068; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024198; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024164; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024282; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024195; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024823; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023317; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023636; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000025295; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049523; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0049505; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0049466; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049467; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049199; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049949; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049301; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0049129; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0049226; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0049201; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0049350; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049202; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050064; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048899; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048492; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1405
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             300..1202
FT                   /codon_start=1
FT                   /gene="Spry4"
FT                   /product="sprouty 4"
FT                   /db_xref="GOA:Q9WTP2"
FT                   /db_xref="InterPro:IPR007875"
FT                   /db_xref="InterPro:IPR030790"
FT                   /db_xref="MGI:MGI:1345144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTP2"
FT                   /protein_id="AAD56007.1"
FT                   /translation="MEPPVPQSSFPVNPSSVMVQPLLDSRAPHSRLQHPLTILPIDQMK
FT                   TSHVENDYIDNPSLAPATGPKRPRGGPPELAPTPARCDQDITHHWISFSGRPSSVSSSS
FT                   STSSDQRLLDHMAPPPVAEQASPRAVRLQPKVVHCKPLDLKGPTAPPELDKHFLLCEAC
FT                   GKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCAD
FT                   HPCSCSGSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNS
FT                   VICKAASGDTKTSRSDKPF"
XX
SQ   Sequence 1405 BP; 292 A; 457 C; 375 G; 281 T; 0 other;
     gcacgaggcg cgcgtgcgca ctggagctct ctgccctccc attcataaaa aagccatttt        60
     cccaggcaag ggttgcaaca tcgccgctga ggcagcgaac agagctgaca gcgcggagct       120
     ggcgctgcag ggctcaggga gctttgccgg ctcctccgac tgacgtctgc gacttcaacg       180
     gcgactgacc cactcgggtt cggggattta cacagacgtg gagcgatgct tgtgactctg       240
     cagctcctca aagaccccta gaagcctgtc ccttggtgca gttcaggacc tccagcctca       300
     tggagccccc ggttccacag agcagcttcc ctgtgaatcc cagctcagtc atggtgcagc       360
     ccctccttga cagcagagcg ccccacagcc ggctccagca cccactcacc atcttaccca       420
     ttgaccagat gaagaccagc cacgtggaga atgactacat agacaaccct agcctggccc       480
     ctgccacggg tcccaagcgg ccccggggcg ggccaccaga gctggctcct acacctgccc       540
     gctgtgacca ggatattact caccactgga tctccttcag cggtcggccc agctctgtaa       600
     gcagcagtag cagcacttcc tccgaccaga ggctcctaga tcacatggct ccaccgcccg       660
     tggctgagca ggcctcaccc agggctgtgc gcctccagcc caaggtggtt cactgtaagc       720
     cgctggacct caaaggcccg acagctccgc cagagctaga caagcacttc ttgctgtgtg       780
     aggcctgtgg aaagtgtaag tgcaaagagt gtgcgtcccc tcggacgtta ccttcctgct       840
     gggtctgcaa ccaggagtgc ctgtgctcgg ctcagacgct ggtcaactat ggcacatgca       900
     tgtgtctggt gcaaggtatc ttctatcact gtactaatga ggatgatgag ggctcttgcg       960
     ccgaccaccc ctgctcctgt tccggctcca actgctgcgc ccgctggtcc ttcatgggcg      1020
     ccctctctgt ggtgctgccc tgtctgctgt gctacctgcc ggccacaggc tgcgtcaagc      1080
     tggcccagcg aggctacgac cgcctgagac gccccggttg ccgctgcaag cacacgaaca      1140
     gcgtcatctg caaggcagcc agtggggaca ccaagaccag caggtctgac aagcctttct      1200
     gacactttgg atgaaaaaaa catggtccct cctgccagtc tcctgagact gaccttgctc      1260
     atctgtcctc tcctaaaacc ctagattggg aagaaaccgg cagagaacac tactgcctag      1320
     ccttgagtcc ccaaaaggat gaagatgtac tttggggatt ttcacaagtc ttgaaacttt      1380
     gttaaacagc agtgacagtg ttagg                                            1405
//