Dbfetch

ID   AF176905; SV 1; linear; mRNA; STD; MUS; 1519 BP.
XX
AC   AF176905;
XX
DT   23-SEP-1999 (Rel. 61, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus sprouty 2 (Spry2) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1519
RX   PUBMED; 10498682.
RA   Minowada G., Jarvis L.A., Chi C.L., Neubuser A., Sun X., Hacohen N.,
RA   Krasnow M.A., Martin G.R.;
RT   "Vertebrate Sprouty genes are induced by FGF signaling and can cause
RT   chondrodysplasia when overexpressed";
RL   Development 126(20):4465-4475(1999).
XX
RN   [2]
RP   1-1519
RA   Minowada G., Martin G.R.;
RT   ;
RL   Submitted (11-AUG-1999) to the INSDC.
RL   Anatomy, University of California, San Francisco, 513 Parnassus, San
RL   Francisco, CA 94143, USA
XX
DR   MD5; 9840813d07ef3556e9526ca10480f79b.
DR   Ensembl-Gn; ENSMUSG00000022114; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021638; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021596; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021572; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021602; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021380; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022042; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020897; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021348; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021472; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021449; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021540; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021476; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022065; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020640; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020950; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022709; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0040333; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0040297; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0040255; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0040296; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0040036; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0040769; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0040056; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0039953; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0040103; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0040063; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0040174; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0040058; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0040809; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0039659; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0039432; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1519
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             287..1234
FT                   /codon_start=1
FT                   /gene="Spry2"
FT                   /product="sprouty 2"
FT                   /db_xref="GOA:Q9QXV8"
FT                   /db_xref="InterPro:IPR007875"
FT                   /db_xref="InterPro:IPR030780"
FT                   /db_xref="MGI:MGI:1345138"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QXV8"
FT                   /protein_id="AAD56006.1"
FT                   /translation="MEARAQSGNGSQPLLQTAHDSGRQRGEPDPRDALTQQVHVLSLDQ
FT                   IRAIRNTNEYTEGPTVVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQPSQVHSSRA
FT                   PLSRSISTVSSGSRSSTRTSTSSSSSEQRLLGPSFSHGPAAADGIIRVQPKSELKPGDV
FT                   KPLSKDDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCV
FT                   KGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQG
FT                   CYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT"
XX
SQ   Sequence 1519 BP; 346 A; 389 C; 404 G; 380 T; 0 other;
     cggccgcgtg cgcttctgga agggaggtca tctatcccgg aatccgggag ggttccaacg        60
     gtggaggact gggttccaaa atttccccgt ggttttaatc caccgattgc ttggaagttg       120
     gactgaagca gagtttggaa agaaggaaaa agtttgcatc aggactggat ttatttgcac       180
     atcgctggaa gaagaggatt caagggagag gggttggtgc aaagccgcga tcacggagtt       240
     cagatgtgtt ctaagcctgc tggggtgaac acactgccaa gacctgatgg aggccagagc       300
     tcagagtggc aacgggtcgc agcctttgct gcagacagcc catgacagtg gcaggcagcg       360
     cggggagccg gatccaagag atgcccttac ccagcaggta cacgtcttgt ctctggatca       420
     gatcagagcc atccgaaaca ccaatgagta cacagagggc cctactgtgg tcccaagacc       480
     tgggctcaag cctgctcctc gcccctccac tcagcacaaa catgaaagac tccacggtct       540
     gccggagcac cgccagcctc ccaggctcca gccctcgcag gtccattctt cacgggcccc       600
     tctgtccagg tccatcagca ctgtcagctc agggtctcgg agcagtacaa ggacaagtac       660
     cagcagcagc tcctcggaac agagactgtt aggaccgtcc ttctcccacg ggcctgctgc       720
     tgctgatgga ataatccgag tgcagcctaa atcggagctc aagcctggtg acgttaagcc       780
     actgagcaag gatgatttgg gtctgcatgc ctacaggtgt gaggactgcg gcaagtgcaa       840
     gtgtaaggag tgcacctacc cgaggcccct gccgtcggac tggatctgtg acaagcagtg       900
     cctctgctca gcccagaacg tcattgacta tgggacttgt gtgtgctgtg tgaaaggtct       960
     cttctatcac tgctccaatg acgatgagga caattgtgct gacaacccgt gctcttgcag      1020
     ccagtcccat tgttgtacgc gatggtcagc gatgggagtc atgtctctct ttttgccttg      1080
     tttatggtgt taccttccag ccaagggttg ccttaaattg tgccaggggt gttatgaccg      1140
     agtgaacagg ccgggttgtc gttgtaaaaa ctcaaataca gtttgctgca aagttcccac      1200
     tgtcccccct aggaactttg aaaagccgac atagcattat taatcaggaa tattgcagta      1260
     atagggattg ttgctccgcc ccctcccatc ccccccccct tttaacacat atgcaaccaa      1320
     ctaaacagtt gtaatcttgg cactgttcgt agagggttag gggatttgtg gtttgcagtg      1380
     agaggctttt ctttctcttt tccttttttt tttttttttt tttttttttt ttttttttgg      1440
     tccatgtgcc attttaactg atacgcttgc tacaattcag ctaatggaac ccgaaggaag      1500
     aacaacagaa gttggagcc                                                   1519
//