spacer

EBI Dbfetch

ID   AF175265; SV 1; linear; mRNA; STD; HUM; 2726 BP.
XX
AC   AF175265;
XX
DT   02-AUG-2000 (Rel. 64, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens vacuolar sorting protein 35 (VPS35) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2726
RX   PUBMED; 11102511.
RA   Renfrew Haft C., Sierra M.L., Bafford R., Lesniak M.A., Barr V.A.,
RA   Taylor S.I.;
RT   "Human orthologs of yeast vacuolar protein sorting proteins Vps26, 29, and
RT   35: assembly into multimeric complexes";
RL   Mol. Biol. Cell 11(12):4105-4116(2000).
XX
RN   [2]
RP   1-2726
RA   Renfrew Haft C., Sierra L., Taylor S.I.;
RT   ;
RL   Submitted (04-AUG-1999) to the INSDC.
RL   Diabetes Branch, National Institutes of Health, 10 Center Dr., MSC-1770,
RL   Bethesda, MD 20892, USA
XX
DR   MD5; 0e0ad684ed02373b2e3da50a45975668.
DR   Ensembl-Gn; ENSG00000069329; homo_sapiens.
DR   Ensembl-Tr; ENST00000299138; homo_sapiens.
DR   EuropePMC; PMC15060; 11102511.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2726
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="HCC"
FT                   /cell_type="carcinoma"
FT                   /tissue_type="colon"
FT                   /db_xref="taxon:9606"
FT   CDS             58..2448
FT                   /codon_start=1
FT                   /gene="VPS35"
FT                   /product="vacuolar sorting protein 35"
FT                   /note="retromer protein; similar to MEM3"
FT                   /db_xref="GOA:Q96QK1"
FT                   /db_xref="H-InvDB:HIT000072619.12"
FT                   /db_xref="HGNC:HGNC:13487"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:2R17"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96QK1"
FT                   /protein_id="AAF89953.1"
FT                   /translation="MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKH
FT                   ASNMLGELRTSMLSPKSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNI
FT                   IPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPD
FT                   EGEPPDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQGHSRDREKRERERQELRILVGT
FT                   NLVRLSQLEGVNVERYKQIVLTGILEQVVNCRDALAQEYLMECIIQVFPDEFHLQTLNP
FT                   FLRACAELHQNVNVKNIIIALIDRLALFAHREDGPGIPADIKLFDIFSQQVATVIQSRQ
FT                   DMPSEDVVSLQVSLINLAMKCYPDRVDYVDKVLETTVEIFNKLNLEHIATSSAVSKELT
FT                   RLLKIPVDTYNNILTVLKLKHFHPLFEYFDYESRKSMSCYVLSNVLDYNTEIVSQDQVD
FT                   SIMNLVSTLIQDQPDQPVEDPDPEDFADEQSLVGRFIHLLRSEDPDQQYLILNTARKHF
FT                   GAGGNQRIRFTLPPLVFAAYQLAFRYKENSKVDDKWEKKCQKIFSFAHQTISALIKAEL
FT                   AELPLRLFLQGALAAGEIGFENHETVAYEFMSQAFSLYEDEISDSKAQLAAITLIIGTF
FT                   ERMKCFSEENHEPLRTQCALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGK
FT                   RVMECLKKALKIANQCMDPSLQVQLFIEILNRYIYFYEKENDAVTIQVLNQLIQKIRED
FT                   LPNLESSEETEQINKHFHNTLEHLRLRRESPESEGPIYEGLIL"
XX
SQ   Sequence 2726 BP; 823 A; 545 C; 599 G; 759 T; 0 other;
     aggaattcgg cacgaggcgg ggcgggtgct gcttgctgca ggctctgggg agtcgccatg        60
     cctacaacac agcagtcccc tcaggatgag caggaaaagc tcttggatga agccatacag       120
     gctgtgaagg tccagtcatt ccaaatgaag agatgcctgg acaaaaacaa gcttatggat       180
     gctctaaaac atgcttctaa tatgcttggt gaactccgga cttctatgtt atcaccaaag       240
     agttactatg aactttatat ggccatttct gatgaactgc actacttgga ggtctacctg       300
     acagatgagt ttgctaaagg aaggaaagtg gcagatctct acgaacttgt acagtatgct       360
     ggaaacatta tcccaaggct ttaccttttg atcacagttg gagttgtata tgtcaagtca       420
     tttcctcagt ccaggaagga tattttgaaa gatttggtag aaatgtgccg tggtgtgcaa       480
     catcccttga ggggtctgtt tcttcgaaat taccttcttc agtgtaccag aaatatctta       540
     cctgatgaag gagagccacc agatgaagaa acaactggtg acatcagtga ttccatggat       600
     tttgtactgc tcaactttgc agaaatgaac aagctctggg tgcgaatgca gcatcaggga       660
     catagccgag atagagaaaa aagagaacga gaaagacaag aactgagaat tttagtggga       720
     acaaatttgg tgcgcctcag tcagttggaa ggtgtaaatg tggaacgtta caaacagatt       780
     gttttgactg gcatattgga gcaagttgta aactgtaggg atgctttggc tcaagaatat       840
     ctcatggagt gtattattca ggttttccct gatgaatttc acctccagac tttgaatcct       900
     tttcttcggg cctgtgctga gttacaccag aatgtaaatg tgaagaacat aatcattgct       960
     ttaattgata gattagcttt atttgctcac cgtgaagatg gacctggaat cccagcggat      1020
     attaaacttt ttgatatatt ttcacagcag gtggctacag tgatacagtc tagacaagac      1080
     atgccttcag aggatgttgt atctttacaa gtctctctga ttaatcttgc catgaaatgt      1140
     taccctgatc gtgtggacta tgttgataaa gttctagaaa caacagtgga gatattcaat      1200
     aagctcaacc ttgaacatat tgctaccagt agtgcagttt caaaggaact caccagactt      1260
     ttgaaaatac cagttgacac ttacaacaat attttaacag tcttgaaatt aaaacatttt      1320
     cacccactct ttgagtactt tgactacgag tccagaaaga gcatgagttg ttatgtgctt      1380
     agtaatgttc tggattataa cacagaaatt gtctctcaag accaggtgga ttccataatg      1440
     aatttggtat ccacgttgat tcaagatcag ccagatcaac ctgtagaaga ccctgatcca      1500
     gaagattttg ctgatgagca gagccttgtg ggccgcttca ttcatctgct gcgctctgag      1560
     gaccctgacc agcagtactt gattttgaac acagcacgaa aacattttgg agctggtgga      1620
     aatcagcgga ttcgcttcac actgccacct ttggtatttg cagcttacca gctggctttt      1680
     cgatataaag agaattctaa agtggatgac aaatgggaaa agaaatgcca gaagattttt      1740
     tcatttgccc accagactat cagtgctttg atcaaagcag agctggcaga attgccctta      1800
     agactttttc ttcaaggagc actagctgct ggggaaattg gttttgaaaa tcatgagaca      1860
     gtcgcatatg aattcatgtc ccaggcattt tctctgtatg aagatgaaat cagcgattcc      1920
     aaagcacagc tagctgccat caccttgatc attggcactt ttgaaaggat gaagtgcttc      1980
     agtgaagaga atcatgaacc tctgaggact cagtgtgccc ttgctgcatc caaacttcta      2040
     aagaaacctg atcagggccg agctgtgagc acctgtgcac atctcttctg gtctggcaga      2100
     aacacggaca aaaatgggga ggagcttcac ggaggcaaga gggtaatgga gtgcctaaaa      2160
     aaagctctaa aaatagcaaa tcagtgcatg gacccctctc tacaagtgca gctttttata      2220
     gaaattctga acagatatat ctatttttat gaaaaggaaa atgatgcggt aacaattcag      2280
     gttttaaacc agcttatcca aaagattcga gaagacctcc cgaatcttga atccagtgaa      2340
     gaaacagagc agattaacaa acattttcat aacacactgg agcatttgcg cttgcggcgg      2400
     gaatcaccag aatccgaggg gccaatttat gaaggtctca tcctttaaaa aggaaatagc      2460
     tcaccatact cctttccatg tacatccagt gagggtttta ttacgctagg tttcccttcc      2520
     atagattgtg cctttcagaa atgctgaggt aggtttccca tttcttacct gtgatgtgtt      2580
     ttacccagca cctccggaca ctcaccttca ggaccttaat aaaattattc acttggtaag      2640
     tgttcaagtc tttctgatca ccccaagtag catgactgat ctgcaattta aaattcctgt      2700
     gatctgtaaa aaaaaaaaaa aaaaaa                                           2726
//


spacer
spacer