Dbfetch

ID   AF172334; SV 1; linear; mRNA; STD; MUS; 995 BP.
XX
AC   AF172334;
XX
DT   24-AUG-1999 (Rel. 60, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus ubiquitin carboxyl-terminal hydrolase PGP9.5 (Uch-L1) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-995
RX   DOI; 10.1016/S0531-5565(02)00117-1.
RX   PUBMED; 12559414.
RA   Marzban G., Grillari J., Reisinger E., Hemetsberger T., Grabherr R.,
RA   Katinger H.;
RT   "Age-related alterations in the protein expression profile of C57BL/6J
RT   mouse pituitaries";
RL   Exp. Gerontol. 37(12):1451-1460(2002).
XX
RN   [2]
RP   1-995
RA   Marzban G., Grillari J., Reisinger E., Hemetsberger T., Hohenwarter O.,
RA   Katinger H.;
RT   ;
RL   Submitted (26-JUL-1999) to the INSDC.
RL   Institute of Applied Microbiology, University of Agricultural Sciences,
RL   Muthgasse 18, Vienna A-1190, Austria
XX
DR   MD5; a4e9170897296af5f41928b0c191feed.
DR   Ensembl-Gn; ENSMUSG00000029223; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029590; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029558; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029506; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029567; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029290; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030021; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028698; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029259; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029405; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029365; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029490; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029393; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030054; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028422; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028778; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000031131; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071926; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0072010; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0071923; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071941; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071581; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072414; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072123; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0071534; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0071674; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0071572; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0071723; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071597; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072612; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071595; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070733; mus_musculus_wsbeij.
DR   EuropePMC; PMC1142397; 15911766.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..995
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /tissue_type="pituitary gland"
FT                   /db_xref="taxon:10090"
FT   CDS             9..680
FT                   /codon_start=1
FT                   /gene="Uch-L1"
FT                   /product="ubiquitin carboxyl-terminal hydrolase PGP9.5"
FT                   /db_xref="GOA:Q9R0P9"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR030297"
FT                   /db_xref="MGI:MGI:103149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0P9"
FT                   /protein_id="AAD51029.1"
FT                   /translation="MQLKPMEINPEMLNKVLAKLGVAGQWRFADVLGLEEETLGSVPSP
FT                   ACALLLLFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQD
FT                   KLEFEDGSVLKQFLSETEKLSPEDRAKCFEKNEAIQAAHDSVAQKGQCRVDDKVNFHFI
FT                   LFNNVDGHLYELDGRMPFPVNHGASSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKA
FT                   A"
FT   regulatory      959..965
FT                   /gene="Uch-L1"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      985
FT                   /gene="Uch-L1"
XX
SQ   Sequence 995 BP; 232 A; 275 C; 272 G; 216 T; 0 other;
     ctaaagagat gcagctgaag ccgatggaga ttaaccccga gatgctgaac aaagtgttgg        60
     ccaagctggg ggtcgccggc cagtggcgct tcgccgacgt gctagggctg gaggaggaga       120
     ctctgggctc agtgccatcc cctgcctgcg ccctgctgct cctgtttccc ctcacggccc       180
     agcatgaaaa cttcaggaaa aagcaaattg aggaactgaa gggacaggaa gttagcccta       240
     aagtttactt catgaagcag accatcggaa actcctgtgg taccatcggg ttgatccacg       300
     cagtggccaa caaccaagac aagctggaat ttgaggatgg atccgtcctg aaacagtttc       360
     tgtctgaaac ggagaagctg tcccccgaag atagagccaa gtgtttcgag aagaacgagg       420
     ccatccaggc agcccatgac tccgtggccc agaagggcca gtgtcgggta gatgacaaag       480
     tgaatttcca ttttattctg ttcaacaacg tggacggcca tctgtacgag ctcgatgggc       540
     gaatgccctt tccagtgaac catggcgcca gctcagagga ctctctgctg caggatgctg       600
     ccaaggtctg cagagaattc actgagcgcg agcaggggga ggtccgcttc tctgccgtgg       660
     ctctctgcaa agcagcttaa gtctggggag agagaaccag ccgatccccc cttccctggg       720
     caggtgcgcg cggccccgcc cttggtttgc agctttagca cttagaacca cagctgtctt       780
     cttgcgttct acagccccat cccctccacc ccacccaggc caccaggggg ctctgtcaca       840
     gccacaccag gctgagcact ttccctcctg tgtgtctcgt accttgctct ctacggtctc       900
     tttggtttct gtctgtaagt tatggccctg gatgggtttg tctagtcctt aaaaggaaga       960
     ataaaacttt gctggtgaga gtatcaaaaa aaaaa                                  995
//