
ID   AF172326; SV 1; linear; genomic DNA; STD; MUS; 2152 BP.
AC   AF172326;
DT   01-SEP-1999 (Rel. 60, Created)
DT   03-MAR-2000 (Rel. 62, Last updated, Version 3)
DE   Mus musculus neurotensin receptor (Ntr1) gene, promoter region and partial
DE   cds.
KW   .
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
RN   [1]
RP   1-2152
RX   DOI; 10.1074/jbc.274.42.30066.
RX   PUBMED; 10514493.
RA   Tavares D., Tully K., Dobner P.R.;
RT   "Sequences required for induction of neurotensin receptor gene expression
RT   during neuronal differentiation of N1E-115 neuroblastoma cells";
RL   J Biol Chem 274(42):30066-30079(1999).
RN   [2]
RP   1-2152
RA   Tavares D., Tully K., Dobner P.R.;
RT   ;
RL   Submitted (26-JUL-1999) to the INSDC.
RL   Molecular Genetics and Microbiology, University of Massachusetts Medical
RL   School, 55 Lake Ave. North, Worcester, MA 01655, USA
DR   MD5; 2f56599f023690468468b06dff4888c1.
FH   Key             Location/Qualifiers
FT   source          1..2152
FT                   /organism="Mus musculus"
FT                   /strain="129"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            <2057..>2152
FT                   /gene="Ntr1"
FT                   /product="neurotensin receptor"
FT   CDS             2057..>2152
FT                   /codon_start=1
FT                   /gene="Ntr1"
FT                   /product="neurotensin receptor"
FT                   /note="G-protein linked receptor"
FT                   /db_xref="UniProtKB/TrEMBL:Q9QZQ2"
FT                   /protein_id="AAD51806.1"
FT                   /translation="MHLNSSVQQGAPSEPGAQPFPHPQFGLETMLL"
SQ   Sequence 2152 BP; 491 A; 626 C; 636 G; 399 T; 0 other;
     aagctttgga gacacaaggc tggcttagcc aaaaggtcag gactagaaaa ctaaacatga        60
     actatgctgc ctttgagatg gcctctccac gtggctgcag ctcctgttgc caaacggata       120
     tactgctgtg gtcaccgtct aggaccctcc tctggggaat cccctgatgg aggaggccag       180
     acggcactgt tggtggttga gtttgggtga gaccaaggac accacagggg agtgagacat       240
     gggatcatat atagcctagt gctactactt cctaatcatg caggccctcc ccagccctcc       300
     ccatgctcat taagttggtg cacagaatct gtcggagaac aaatctagtc tcaagcccac       360
     cttacccgca gtcaatgggc aagcagccac aacccatcag ggcaggtttc aagttccctt       420
     ccacaatgga agaagctgag gcttgcccaa atattagaag cctggtcaac ccctacaccc       480
     tcagcctgct gtactggctt ctcttaaggg gacacagtag tttcctttga aaccaagtgt       540
     ttaagctctg cttttcatgt gttaacattc tgtggagggc accagctttt gtgtgagtag       600
     gcactgaagc ctgagggtcg ctgctgcgca gggatccagg gaggagtttt ctggaggaag       660
     agggcaggag aaaggctgag agagccaagt ggggaaatag aggcaagggc cctggggcaa       720
     gcaagatggc agcaagcctg gaagctctgg ccagggcccc tgccaaagag gacaagatga       780
     aaagaccttt gttccccggg tccctgactg gggcagggtc ccctgagaaa agctgtgctg       840
     ggctgagtgc acaggcttca gggtttcctg caaggacaga cgcagctctg tgtcgcccac       900
     aaacctgccc ttcccctctg aaacgacagg gcaccagctc tgagagtcac tgctagtgac       960
     caaatccagg tggctacagg agggcagaag gtcccatcat acccaaaggc agctaagacc      1020
     gtgagactgc gtggagagat gggctgctct aacttcctgc tctatgcttt ccttcaccag      1080
     acccttcaca ggctagaggg ccccctggtg cttctggcac cccacaggca cccagaaggg      1140
     aggaggtcga ggcagttgta caaaggccct gacttatcag cagggtgccg cctccttctc      1200
     cgccttcccc tcgagtacac cctcgtgtca ctaagggagc tgaagacggc tacggggagc      1260
     tttctttttg gggtgggaga agttgggacc aacgatcgtg aaagaaagat cgtgctgccc      1320
     aggagaggtt gaaaggaaag atccaatatc ccctcattct ccctcgcctg gtagggaatt      1380
     ctgcttcctg gggtactcat cctagcccag gtggtccccg ggagcgtgca ggagcaaccg      1440
     tcagccagta tccgggtggg gaggggacag tggctgtggc gtctctgact ctccaacacc      1500
     caccctcctc cactgctggg cgcgccgcgc agccgccagc tcagtggaag cgcgaggagc      1560
     ccggcaggct ccggcgcagc aggaggtgtg cgaagtcggg tgcgggaaga gctccaagca      1620
     gaagagggag aacgagggtg agcacgctgg gcagccgtgc gtgcgctcct ctctgcgcca      1680
     caggctcgcc caacgaagca caagccagca gggtcgcggt cctgaggaca tcgctgccac      1740
     ccaggagtgc agagaaccaa ccacagaatc tgaggtcggt agcagcctcg atctaggcag      1800
     gctcggagcc agggggggtg ccgaggaaga accggaaagc agatcccaga ctctgaagga      1860
     gaaagaagag tggatccctg agccggcacg tctcgagccc cagagctccc aggatctcct      1920
     ggatagctgg cttcgccgcc ggacggcacg ccccccttag cttccacacc ctctcctctg      1980
     agcgcctcct catctgcccc tggagggact ttcaccttca aaggtgcagg acaaagccgc      2040
     atatctggcg cccaccatgc acctcaacag ctccgtgcag cagggagccc caagtgaacc      2100
     cggtgcccag cccttcccac atccacagtt cggactggag acgatgctcc tg              2152