spacer

EBI Dbfetch

ID   AF170701; SV 1; linear; genomic DNA; STD; MUS; 675 BP.
XX
AC   AF170701;
XX
DT   09-NOV-1999 (Rel. 61, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Mus musculus metabotropic glutamate receptor 3 protein (Grm3) gene, exon 6
DE   and complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-675
RX   PUBMED; 10544282.
RA   Minoshima T., Nakanishi S.;
RT   "Structural organization of the mouse metabotropic glutamate receptor
RT   subtype 3 gene and its regulation by growth factors in cultured cortical
RT   astrocytes";
RL   J. Biochem. 126(5):889-896(1999).
XX
RN   [2]
RP   1-675
RA   Minoshima T.;
RT   ;
RL   Submitted (19-JUL-1999) to the INSDC.
RL   Department of Biological Sciences, Kyoto University Faculty of Medicine,
RL   Yoshida, Sakyo-ku, Kyoto 606-8501, Japan
XX
DR   MD5; 160c03f9cbc1697adc2c6ab5a35221e8.
DR   Ensembl-Gn; ENSMUSG00000003974; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004076; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..675
FT                   /organism="Mus musculus"
FT                   /strain="129/Sv"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(AF170696.1:451..673,AF170697.1:48..656,
FT                   AF170698.1:51..906,AF170699.1:51..1117,AF170700.1:51..225,
FT                   51..650)
FT                   /gene="Grm3"
FT                   /product="metabotropic glutamate receptor 3"
FT   CDS             join(AF170697.1:189..656,AF170698.1:51..906,
FT                   AF170699.1:51..1117,AF170700.1:51..225,51..124)
FT                   /codon_start=1
FT                   /gene="Grm3"
FT                   /product="metabotropic glutamate receptor 3 protein"
FT                   /db_xref="GOA:Q9QYS2"
FT                   /db_xref="InterPro:IPR000162"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001234"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR017979"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1351340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QYS2"
FT                   /protein_id="AAF06741.1"
FT                   /translation="MKMLTRLQVLMLALFSKGFLVSLGDHNFMRREIKIEGDLVLGGLF
FT                   PINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTY
FT                   ALEQSLEFVRASLTKVDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRL
FT                   FQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRYFNWTYVSTVASEGDY
FT                   GETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDS
FT                   RELIAAASRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSL
FT                   NPYNNHRNPWFRDFWEQKFQCSLQNKRNHRQICDKHLAIDSSNYEQESKIMFVVNAVYA
FT                   MAHALHKMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKGADSIVKFDT
FT                   YGDGMGRYNVFNFQHIGGKYSYLKVGHWAETLYLDVDSIHWSRNSVPTSQCSDPCAPNE
FT                   MKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPEDYIRWEDAW
FT                   AIGPVTIACLGFMCTCIVITVFIKHNNTPLVKASGRELCYILLFGVSLSYCMTFFFIAK
FT                   PSPVICALRRLGLGTSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLG
FT                   LILVQIVMVSVWLILETPGTRRYTLPEKRETVILKCNVKDSSMLISLTYDVVLVILCTV
FT                   YAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGF
FT                   VVLGCLFAPKVHIVLFQPQKNVVTHRLHLNRFSVSGTATTYSQSSASTYVPTVCNGREV
FT                   LDSTTSSL"
FT   exon            51..650
FT                   /gene="Grm3"
FT                   /number=6
XX
SQ   Sequence 675 BP; 215 A; 125 C; 125 G; 210 T; 0 other;
     taactaagtg tcctgcttaa ctaagtcttg tgtcccactt tgttttgcag cctctgcaag        60
     cacatatgtc ccgacagtgt gcaacggaag ggaagtcctg gactccacca cctcatctct       120
     gtgattgtga ctcgcagttc agttctgttt ataggctgtt agacgaagtg ctcacatgct       180
     gctccagaat atggaaacag aacaaaaaca acaaccctag tacctttttt tttttttttt       240
     ttagaaacag taaaataaat tatttttgag gactgtatgg tatatagtga tgtgctacaa       300
     ctttctaggc tgattttagt gcccctatta acagcccctc cccaggacat ggaaataacc       360
     attgtttaca gagctgagca ttggtgacag ggtctgacag ggtcagtcta ctaaaagaaa       420
     acaaaacaaa acaaaaaaac aaaaacaaaa aaataataca gtggcaatat taggtaacct       480
     ttttcctatg aagtcttttg taggttcttg ttgtaactaa tatagggtga gtttctacgt       540
     tgtatattaa agttacattg cgtgtaacag aacgtttttc tcagtacaaa ataaaatgca       600
     tctgtattaa tgtaaagata accagaataa aaccttcaag gttttcaagc atggtggata       660
     acagtttgtc ctttt                                                        675
//


spacer
spacer