Dbfetch

ID   AH008375; SV 2; linear; genomic DNA; STD; MUS; 5400 BP.
XX
AC   AH008375; AF170696-AF170701;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Mus musculus strain 129/Sv metabotropic glutamate receptor 3 protein (Grm3)
DE   gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5400
RX   PUBMED; 10544282.
RA   Minoshima T., Nakanishi S.;
RT   "Structural organization of the mouse metabotropic glutamate receptor
RT   subtype 3 gene and its regulation by growth factors in cultured cortical
RT   astrocytes";
RL   J. Biochem. 126(5):889-896(1999).
XX
RN   [2]
RP   1-5400
RA   Minoshima T.;
RT   ;
RL   Submitted (19-JUL-1999) to the INSDC.
RL   Department of Biological Sciences, Kyoto University Faculty of Medicine,
RL   Yoshida, Sakyo-ku, Kyoto 606-8501, Japan
XX
DR   MD5; 81e5630d5ba17afcc2583ccaff165d91.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:6288793, gi:6288794, gi:6288795, gi:6288796, gi:6288797,
CC   gi:6288798, gi:6288799.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5400
FT                   /organism="Mus musculus"
FT                   /strain="129/Sv"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            451..5375
FT                   /gene="Grm3"
FT                   /note="mGluR3"
FT   mRNA            join(451..673,1287..1895,2056..2911,3162..4228,4400..4574,
FT                   4776..5375)
FT                   /gene="Grm3"
FT                   /product="metabotropic glutamate receptor 3"
FT   exon            451..673
FT                   /gene="Grm3"
FT                   /number=1
FT   gap             1140..1239
FT                   /estimated_length=unknown
FT   exon            1287..1895
FT                   /gene="Grm3"
FT                   /number=2
FT   CDS             join(1428..1895,2056..2911,3162..4228,4400..4574,
FT                   4776..4849)
FT                   /codon_start=1
FT                   /gene="Grm3"
FT                   /product="metabotropic glutamate receptor 3 protein"
FT                   /protein_id="AAF06741.1"
FT                   /translation="MKMLTRLQVLMLALFSKGFLVSLGDHNFMRREIKIEGDLVLGGLF
FT                   PINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTY
FT                   ALEQSLEFVRASLTKVDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRL
FT                   FQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRYFNWTYVSTVASEGDY
FT                   GETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDS
FT                   RELIAAASRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSL
FT                   NPYNNHRNPWFRDFWEQKFQCSLQNKRNHRQICDKHLAIDSSNYEQESKIMFVVNAVYA
FT                   MAHALHKMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKGADSIVKFDT
FT                   YGDGMGRYNVFNFQHIGGKYSYLKVGHWAETLYLDVDSIHWSRNSVPTSQCSDPCAPNE
FT                   MKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPEDYIRWEDAW
FT                   AIGPVTIACLGFMCTCIVITVFIKHNNTPLVKASGRELCYILLFGVSLSYCMTFFFIAK
FT                   PSPVICALRRLGLGTSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLG
FT                   LILVQIVMVSVWLILETPGTRRYTLPEKRETVILKCNVKDSSMLISLTYDVVLVILCTV
FT                   YAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGF
FT                   VVLGCLFAPKVHIVLFQPQKNVVTHRLHLNRFSVSGTATTYSQSSASTYVPTVCNGREV
FT                   LDSTTSSL"
FT   gap             1906..2005
FT                   /estimated_length=unknown
FT   exon            2056..2911
FT                   /gene="Grm3"
FT                   /number=3
FT   gap             3012..3111
FT                   /estimated_length=unknown
FT   exon            3162..4228
FT                   /gene="Grm3"
FT                   /number=4
FT   gap             4250..4349
FT                   /estimated_length=unknown
FT   exon            4400..4574
FT                   /gene="Grm3"
FT                   /number=5
FT   gap             4626..4725
FT                   /estimated_length=unknown
FT   exon            4776..5375
FT                   /gene="Grm3"
FT                   /number=6
XX
SQ   Sequence 5400 BP; 1282 A; 1139 C; 1208 G; 1271 T; 500 other;
     agagaagctc tcaaccccgc caggctttct gtattgtaac ctttgggtct aggtacagta        60
     gctcactgaa gattctgcag ctacacccct ataaacggag ggaagaaggg ggaagggaaa       120
     ggaggagaga ggaaaggaga agaagaatga ggaggagagg atgtcagaag gtccgtgcct       180
     ctctgcctga gtcccaatta gatgcgactg tttctgcctg gccaaggtga aggaaagttg       240
     cttgtgagcc caggaagtgg gtttggctgc aaagaggagg agggcgcctg ggctctaaag       300
     ctcccctccc ttctgctgaa gaccactggg tccccttctt cccaacctcc tcctgctctt       360
     ctcctctagc cctccctttt cccactcctc cttgactcgg aggcctggat gctgggccac       420
     cgggcagtgg tccagcgcgc agccgggcgg gggcgggggc agggggcact gtgacaggaa       480
     gcttcgcgca caagttggcc atttcagggg caaaataagt tctcccttgg atttagaaag       540
     gacaaaggca gcaagctccc tcttttgtgt cggatgaaga ggaccaacca tgagccagag       600
     cttgggtgca ggctcaccgc tgccgctacc accgcggtca gcttcagttc ctgccaggag       660
     ttgaccgtgc gaggtaagca gcccagaagg ggacctgccc ctctggaggg tgcccagcca       720
     gggcgcagga gctcgggtgc cgcgtggggc aggcaaagcg aggaaagttg aggcagagca       780
     cggaccagtc cctacatatc tatctgccag ggggtggaaa acgtgggtca taggagcaat       840
     gtgggtgtga gtgagagagt gagtttgtgt gtgcgcgcgc tactgtccct tcaagaaggg       900
     gccaatttca gagcatagat ctgcagccag agaaggagag gtagagggac taattagaga       960
     gacaggtctc attctccaac cgcctccatc cagctttgcg cttgggggtt ttataaggct      1020
     ttgtgcacag gaaccctgtg atgtgtggct cacacactgg tagctgcatg tgggtgtgga      1080
     ggttgtcagg caggaggata gcggtcagca ggaccccctg gtgctgccag gataagcttn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnng ttgtttttat aaattatttt      1260
     tgttcatata acttttatct ctttaggaat tcagtgacgg gctcttttag ccctatcctc      1320
     ccttatctga aggacagacc aaagatccta cttggaaatg agaggagact agcaggaaac      1380
     attggaccca ctcagtgata tctccaagag atacagaacc aggattcatg aagatgttga      1440
     caagactaca agttcttatg ttagctttgt tttcaaaggg atttttagtc tctttaggag      1500
     atcacaactt tatgaggaga gaaattaaaa tagaaggaga ccttgtttta gggggcttat      1560
     ttcctattaa tgaaaaaggc actggaactg aagagtgtgg acgaatcaat gaagacagag      1620
     gtatccaacg cctggaggcc atgttgtttg ccattgatga aatcaacaaa gacaattact      1680
     tgcttccagg agtgaagctg ggggttcaca ttttggatac atgttcaaga gacacctatg      1740
     cattagagca gtcactggag tttgtcagag catcgttgac taaagtggat gaagctgaat      1800
     atatgtgtcc tgatggatca tatgctattc aagaaaacat cccactactc attgcaggag      1860
     tcattggcgg ttcgtacagc agtgtttcca tacaggtaag actggnnnnn nnnnnnnnnn      1920
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1980
     nnnnnnnnnn nnnnnnnnnn nnnnncattt gcttctacgt ttttaaaatg gtgactctct      2040
     tttctcccca ctcaggtggc aaacctgctg aggctcttcc agatccctca gataagctac      2100
     gcctccacca gtgccaaact cagcgacaaa tcgcgctatg attattttgc caggaccgtg      2160
     ccccctgact tctaccaggc caaagccatg gccgagatct tgcgctactt taactggacc      2220
     tatgtgtcca ctgttgcctc tgaaggtgac tatggggaga cagggattga ggccttcgag      2280
     caggaagcaa ggctacgcaa catctgcatc gccactgctg aaaaggtggg gcgctccaac      2340
     atccgcaagt cctacgacag cgtgatccgt gagctcctgc agaaacctaa cgcgcgagtt      2400
     gtggtcctgt tcatgcgcag tgatgactca cgagagttga tcgctgcagc cagccgcgtg      2460
     aatgcttcct tcacctgggt ggccagcgat ggctggggtg cacaggagag cattgtcaag      2520
     ggcagtgagc acgtcgccta tggagccatc accctggagc tggcgtccca ccctgttcgt      2580
     cagtttgatc gctacttcca gagcctcaac ccctacaaca atcatcgtaa cccctggttc      2640
     cgagacttct gggagcagaa gttccagtgc agcctccaga acaagagaaa ccacagacag      2700
     atttgtgaca agcacctggc cattgacagc agcaactatg aacaagaatc caagatcatg      2760
     tttgtggtga atgcagtgta tgccatggcg catgcgctgc acaaaatgca acgcaccctc      2820
     tgtcccaaca ccaccaagct ctgtgatgca atgaagatcc tggatggaaa gaagttgtac      2880
     aaagattatt tgctgaaaat caacttcaca ggtaagcagt gggcctttgt cttctgtaat      2940
     atgaacaagt ggactcaacc aggagccaaa ggtttctgct cctaaagaga catccttgct      3000
     ttagaagttt annnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3060
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nagacaccta      3120
     aacaagtgtt cttttctttt ctttcattct gtgtatcaaa gctccattca acccaaataa      3180
     aggagcagac agcattgtga agtttgacac ttacggagac gggatgggaa gatacaacgt      3240
     gttcaacttc cagcatatag gtggaaagta ttcctactta aaagttggcc actgggcaga      3300
     aactttatat ctagatgtgg actctattca ttggtcccgg aactcagtcc ccacttccca      3360
     gtgcagtgat ccctgtgccc ccaatgaaat gaaaaacatg cagccaggag atgtttgctg      3420
     ctggatctgc atcccatgtg agccctatga atacctggtt gatgagttca cctgcatgga      3480
     ttgtggccct ggccagtggc ccactgcaga cctatctgga tgctacaacc ttccagagga      3540
     ttacatcagg tgggaagatg cctgggcaat aggcccagtc actattgcct gcctgggttt      3600
     tatgtgtaca tgcatagtca taactgtttt tatcaagcac aacaacacac ccttggtcaa      3660
     agcatcaggc cgagaactct gctacatctt gttatttgga gttagcctgt cctattgcat      3720
     gacattcttc ttcattgcta agccatcgcc tgtcatctgt gcattgcgcc gacttgggct      3780
     tgggacctcc tttgccatct gttattcagc tctcctgacc aagacaaact gcatcgctcg      3840
     catctttgat ggggtcaaga atggcgctca gaggccaaaa ttcatcagcc ccagttctca      3900
     ggtttttatc tgcctgggtt tgatactggt gcaaattgtg atggtgtctg tgtggcttat      3960
     cttggagact ccaggtacta gaagatacac cctgccagag aagcgggaaa cagtcatcct      4020
     aaaatgcaat gtcaaagatt ccagcatgtt gatctctctg acctatgacg tggttctggt      4080
     gattctatgc actgtgtatg ccttcaaaac aaggaagtgt cctgaaaact tcaatgaagc      4140
     caagttcata ggcttcacca tgtacaccac ctgcatcatc tggttggcat tcctccctat      4200
     attttatgtg acatcaagtg actacagagt aagtctttgg atgctttctn nnnnnnnnnn      4260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnt ctatgatgga atttataact ggacactcat      4380
     tagccaacct ctcttgtagg tgcagacgac aacaatgtgc atctccgtta gcttgagtgg      4440
     tttcgtggtc ttgggctgtt tgtttgcccc caaggtgcac attgtcctgt tccaacccca      4500
     gaagaatgtg gtcacacaca gacttcacct caacaggttc agtgtcagtg gaactgcgac      4560
     cacatattct cagtgtaagt atggaactat gaagattcat tcgtcaatag caccactagg      4620
     gtagcnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4680
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnntaact aagtgtcctg      4740
     cttaactaag tcttgtgtcc cactttgttt tgcagcctct gcaagcacat atgtcccgac      4800
     agtgtgcaac ggaagggaag tcctggactc caccacctca tctctgtgat tgtgactcgc      4860
     agttcagttc tgtttatagg ctgttagacg aagtgctcac atgctgctcc agaatatgga      4920
     aacagaacaa aaacaacaac cctagtacct tttttttttt tttttttaga aacagtaaaa      4980
     taaattattt ttgaggactg tatggtatat agtgatgtgc tacaactttc taggctgatt      5040
     ttagtgcccc tattaacagc ccctccccag gacatggaaa taaccattgt ttacagagct      5100
     gagcattggt gacagggtct gacagggtca gtctactaaa agaaaacaaa acaaaacaaa      5160
     aaaacaaaaa caaaaaaata atacagtggc aatattaggt aacctttttc ctatgaagtc      5220
     ttttgtaggt tcttgttgta actaatatag ggtgagtttc tacgttgtat attaaagtta      5280
     cattgcgtgt aacagaacgt ttttctcagt acaaaataaa atgcatctgt attaatgtaa      5340
     agataaccag aataaaacct tcaaggtttt caagcatggt ggataacagt ttgtcctttt      5400
//