Dbfetch

ID   AF169387; SV 1; linear; mRNA; STD; MUS; 7765 BP.
XX
AC   AF169387;
XX
DT   19-AUG-1999 (Rel. 60, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus alpha 3 collagen IV (Col4a3) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-7765
RX   DOI; 10.1006/geno.1999.5943.
RX   PUBMED; 10534397.
RA   Lu W., Phillips C.L., Killen P.D., Hlaing T., Harrison W.R., Elder F.F.B.,
RA   Miner J.H., Overbeek P.A., Meisler M.H.;
RT   "Insertional mutation of the collagen genes Col4a3 and Col4a4 in a mouse
RT   model of Alport syndrome";
RL   Genomics 61(2):113-124(1999).
XX
RN   [2]
RP   1-7765
RA   Lu W., Phillips C.L., Killen P.D., Hlaing T., Harrison W.R., Elder F.F.B.,
RA   Miner J.H., Overbeek P.A., Meisler M.H.;
RT   ;
RL   Submitted (15-JUL-1999) to the INSDC.
RL   Department of Pathology, Box 0602, University of Michigan, 1301 Catherine,
RL   Ann Arbor, MI 48109-0602, USA
XX
DR   MD5; 9a5cfb608aa485619772617cb854c0ac.
DR   Ensembl-Gn; ENSMUSG00000079465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113457; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7765
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryonic"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             370..5379
FT                   /codon_start=1
FT                   /gene="Col4a3"
FT                   /product="alpha 3 collagen IV"
FT                   /db_xref="GOA:Q9QZS0"
FT                   /db_xref="InterPro:IPR001442"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="MGI:MGI:104688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZS0"
FT                   /protein_id="AAD50449.1"
FT                   /translation="MHSKTAPRFLVFLLLTLLLLLAASPVASKGCVCKGKGQCLCAGTK
FT                   GEKGEKGVPGSPGFPGQKGFPGPEGLPGPQGPKGSPGLPGLTGPKGIRGITGLPGFAGP
FT                   PGLPGLPGHPGPRGLAGLPGCNGSKGEQGFPGFPGTPGYAGLPGPDGLKGQKGEPAQGE
FT                   DRGFNGKGDPGPPGVPGFQGFPGLPGFPGPAGPPGPPGFFGLPGAMGPRGPKGHMGDSV
FT                   IGQKGERGMKGLTGPPGPPGTVIFTLTQPYNKSDFKGEKGDEGERGEPGPPGPSGPPGD
FT                   SYGSEKGAPGEPGPRGKPGKDGAPGFPGTEGAKGNRGFPGLRGEAGIKGRKGDIGPPGF
FT                   PGPTEYYDAYLEKGERGMPGLPGPKGARGPQGPSGPPGVPGSPGLSRPGLRGPIGWPGL
FT                   KGSKGERGPPGKDTVGPPGPLGCPGSPGPPGPPGPPGCPGDIVFKCSPGEHGMPGDTGP
FT                   PGVPGLDGPKGEPGSPCTECHCFPGPPGVPGFPGLDGIKGIPGGRGVPGLKGNPGSPGS
FT                   AGLPGFAGFPGDQGHPGLKGDKGDTPLPWGQVGNPGDPGLRGLPGRKGFDGTPGGPGAK
FT                   GPPGPQGEPALSGRKGDQGPPGPPGFPGPPGPAGPAGPPGYGPQGEPGPKGAQGVPGVL
FT                   GPPGEAGLKGEPSTSTPDLGPPGPPGPPGQAGPRGLPGLPGPVGKCDPGLPGPDGEPGI
FT                   PEAGCPGPPGPKGNQGFPGTKGSPGCPGEMGKPGRPGEPGIPGAKGEPSVGRPGKPGKP
FT                   GFPGERGNAGENGDIGLPGLPGLPGTPGRGGLDGPPGDPGQPGSPGAKGSPGRCIPGPR
FT                   GTQGLPGLNGLKGQPGRRGDTGPKGDPGIPGMDRSGVPGDPGPPGTPGCPGEMGPPGQK
FT                   GYPGAPGFPGPPGEKGEVGMMGYPGTTGPPGLPGKPGSQGQRGSLGIPGMKGEKGRPGA
FT                   KGERGEKGKPGPSQTTLLKGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKGLEGLPGLPG
FT                   PPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGLAGRPGRTGIHGPQ
FT                   GDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGAPGSPGSP
FT                   GHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGE
FT                   KGETGLLGAYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVGPQGPPGTAGLPGPP
FT                   GLPGAIIPGPKGDRGLPGLRGNPGEPGPPGPPGPIGKGIKGDKGFMGPPGPKGLPGTVG
FT                   DMGPPGFPGAPGTPGLPGVRGDPGFPGFPGIKGEKGNPGFLGPIGHPGPVGPKGPPGPR
FT                   GKPGTLKVISLPGSPGPPGVPGQPGMKGDPGPLGLPGIPGPCGPRGKPGKDGKPGTPGP
FT                   AGTKGNKGLKGQQGPPGLDGLPGLKGNPGDRGTPATGTRMRGFIFTRHSQTTAIPSCPE
FT                   GTQPLYSGFSLLFVQGNKRAHGQDLGTLGSCLQRFTTMPFLFCNINNVCNFASRNDYSY
FT                   WLSTPALMPMDMAPISGRALEPYISRCTVCEGPAMAIAVHSQTTAIPPCPQDWVSLWKG
FT                   FSFIMFTSAGSEGAGQALASPGSCLEEFRASPFIECHGRGTCNYYSNSYSFWLASLNPE
FT                   RMFRKPIPSTVKAGDLEKIISRCQVCMKKRH"
XX
SQ   Sequence 7765 BP; 2048 A; 1977 C; 2088 G; 1652 T; 0 other;
     acatcacatc tttcactctg acccctggac gtgcgcccac ctgcctgctc tgcgggcgcc        60
     caaccttttc tcacttcctg ggcaagatgc ccggttgaag ggacagtgcc tggcgaactg       120
     ggagggagag gggacgaggg cggaacctca gccacttctc ccctccctta gagtcacaat       180
     caaaagcttg ggtgaggaca aacagacctc agtgggtcga gcccttacaa aactcgcccc       240
     agtgggccag caaggcgagc gtcactgcgg ggcctctcca atctgtgtcc cgccggggac       300
     atggacgcct gagaacccgt gggtccggta ggtcacagaa cacagaaaac accgggactc       360
     gggaccgtca tgcactccaa gactgctcca aggttcctgg tgttcctgct gcttaccctg       420
     ctgctactcc tggctgcctc tcctgtggct agcaagggct gtgtctgcaa aggcaaagga       480
     caatgcctct gcgcggggac caaaggggag aagggggaga aaggggttcc tggttcccct       540
     ggatttcctg gccagaaagg atttccaggt cctgaaggct tgcctggacc acagggaccc       600
     aagggctccc caggacttcc gggactcact ggccccaaag gcatcagggg aataactgga       660
     ttaccagggt ttgcaggtcc tcctggactt ccaggcctcc caggccaccc tgggcctcgt       720
     gggctggctg gtttaccagg atgcaacgga tctaagggtg aacaaggatt cccgggcttt       780
     cccggcacac caggctatgc agggctccca ggtcctgatg gcttgaaagg acaaaagggt       840
     gagcctgctc aaggagaaga caggggattc aatggaaaag gtgaccctgg gcctccaggg       900
     gttccaggct tccagggttt tccgggactc ccaggttttc cagggcctgc cggtccacca       960
     ggacctccgg gattttttgg tttaccagga gcaatgggac ccagaggacc caaaggccac      1020
     atgggcgata gcgtgatagg acaaaaagga gaaaggggta tgaaaggatt aacaggacct      1080
     cctgggccac caggaacagt gatttttaca ctcacccagc catacaacaa atcggacttc      1140
     aagggagaga aaggagatga gggagagagg ggtgaacccg gacctcctgg accctcgggg      1200
     ccacctggag actcctatgg atcagaaaag ggtgcgcctg gagagcctgg tcctcggggc      1260
     aaacctggaa aagatggtgc ccctggcttc cctggcactg agggagccaa aggcaacagg      1320
     ggctttcctg ggttgagggg tgaagctggc attaagggaa ggaaaggaga cattggcccc      1380
     ccaggatttc ctggtccaac agaatattat gacgcatacc tggaaaaggg agagagagga      1440
     atgccaggcc ttcctgggcc caaaggagcc cgtggcccac agggtccaag tggtccccct      1500
     ggagtccctg gaagtcctgg actgtcaagg cctggcctca gaggacccat tggatggcca      1560
     ggcttgaaag ggagtaaagg agagagagga ccccctggaa aagacactgt gggccctcct      1620
     ggacccctgg gatgtcctgg ctcaccaggt ccaccaggcc ctccaggacc tccaggatgt      1680
     ccaggtgaca ttgtttttaa atgttcccct ggtgagcatg gaatgccagg tgacacagga      1740
     cctccaggag ttccaggact tgatggaccc aaaggagaac caggcagtcc atgcaccgag      1800
     tgtcactgct tcccagggcc ccctggagtc ccaggatttc caggattaga tggtatcaaa      1860
     ggaatcccag gaggacgagg tgtgcctggt ctgaagggaa acccagggtc cccaggaagt      1920
     gcaggtctcc caggatttgc aggattccca ggtgaccaag ggcatccagg acttaaaggg      1980
     gacaaagggg atacacctct accctggggg caagtgggta atccaggtga tcctggactc      2040
     agaggcctgc ccgggagaaa gggcttcgat ggaactcctg gaggtccagg agcgaaagga      2100
     ccaccaggac ctcagggcga accggccctg agtggaagga aaggggacca aggacctcca      2160
     ggacctcctg gattccctgg acccccagga cctgcaggac cagctggacc accaggctat      2220
     ggacctcaag gagagccagg tccaaaggga gcccaaggag tccccggcgt cctgggacca      2280
     cctggagaag ccggtcttaa aggagaaccc agtacatcaa ctccagatct aggtccccca      2340
     ggccctccag ggccccctgg tcaggctggc cccagaggtc tacctggttt gcctggaccg      2400
     gtgggaaaat gtgatcctgg tcttcctgga cctgatggtg agccaggaat tccagaagct      2460
     ggatgcccag ggcctccagg acctaaggga aatcaaggtt tcccagggac aaaaggatca      2520
     cctggttgtc ctggggaaat gggaaagcct ggccgtcctg gagaaccagg catcccagga      2580
     gccaagggag aaccatccgt aggcaggcct gggaaaccag ggaaaccagg ctttccagga      2640
     gaaagaggca atgccgggga aaatggagat attggactcc ctgggcttcc aggcctccct      2700
     ggaactccag gaagaggcgg gcttgacggg cctccaggag acccaggaca gcctggatca      2760
     cctggagcaa aaggatcccc aggaaggtgc ataccaggac ccaggggcac ccaaggactt      2820
     cccggcttga atggattgaa agggcaacca ggtcgaagag gtgataccgg gccaaaggga      2880
     gaccctggca tcccaggcat ggacaggtct ggggtccccg gagatcctgg accaccagga      2940
     acaccaggtt gtcctggtga gatgggacca cctggacaaa aaggatatcc gggagctcca      3000
     ggattcccag gaccaccagg cgagaaagga gaggttggaa tgatgggcta tcctggaacc      3060
     actggccctc cggggcttcc tgggaaacca ggctcacagg ggcagcgagg tagcctcgga      3120
     atcccaggaa tgaaagggga aaaaggacgc ccaggagcca aaggcgaacg aggagagaaa      3180
     ggaaaaccag ggccttctca aacaacactc ttaaagggag acaaaggaga gcctggactt      3240
     aaaggatttg ttgggaatcc aggtgagaaa ggaaacagag gcaacccagg gttaccaggt      3300
     ccgaaaggcc tcgagggatt gcctgggcta ccaggtcctc caggccctag aggagatacg      3360
     ggaagcagag gaaatcctgg aagaccagga ccacacggca tgccaggaag catggggatc      3420
     atgggggtgc caggccctaa agggagaaaa ggaacttcag ggcttccagg tctagctgga      3480
     agaccaggcc ggacagggat ccatggtccc caaggagata agggggagcc gggttattca      3540
     gaaggtgcaa gaccaggacc accaggacca aagggcgatc caggattgcc aggtgacaaa      3600
     ggaaagaaag gagaaagagg cgtacctggg ccacctggac aatcggggcc tgccggacct      3660
     gatggagccc ctgggagtcc tgggagtcct ggtcacccag gaaaaccagg tcctgctggt      3720
     gatttgggtc tgaaaggaca gaaaggcttc ccaggccctc caggaagcac tggccctcca      3780
     ggccctccag gactcccagg acttcctggg ccaatgggta tgagaggtga ccaaggacgt      3840
     gatggaattc ctggtcctcc aggagaaaaa ggagaaacag gcttgctggg ggcctaccca      3900
     ggcccaaaag ggagccctgg tgtaccaggt gccaaaggag acaggggagt tccaggcttg      3960
     tctggccttc ccggcaggaa gggggttatg ggggatgttg gaccccaagg acccccaggc      4020
     actgctggac tcccagggcc accaggtcta cctggggcaa ttatccctgg ccccaaagga      4080
     gacagaggtc ttcctggctt aagaggaaat ccaggtgagc caggtccccc tggacctcca      4140
     ggacctatcg gaaaaggcat aaaaggtgac aaaggattta tgggcccacc tggccccaaa      4200
     ggcctgcctg gaactgtagg ggacatgggc ccaccaggtt tcccgggagc accaggtacc      4260
     cccggtcttc ccggtgtcag aggtgatcca ggattccctg gatttccagg cataaaagga      4320
     gaaaagggta accctggatt tcttgggcca attggacatc caggaccagt tgggcccaaa      4380
     ggaccaccag gtccacgtgg aaaacctggc actcttaagg tcatctctct tccgggaagc      4440
     ccagggccac ctggtgtacc tggacagcca ggaatgaaag gagaccctgg acccctggga      4500
     ctgccaggaa tcccaggacc ctgtgggcca agaggtaaac caggcaagga tgggaaacca      4560
     ggaactccag gaccagctgg tacaaagggc aacaagggct tgaaaggaca gcaaggccca      4620
     cctggtctgg atggattgcc aggcttaaag ggaaatcctg gtgacagggg aacgccggcc      4680
     actggtacaa gaatgcgagg cttcatcttc acccgacaca gtcaaaccac ggccattcct      4740
     tcatgccctg aaggaacaca gccactctat agtgggtttt ctcttctttt tgtacaagga      4800
     aacaaacgtg cacatggaca agacctaggt actctgggca gctgcctgca gcgattcacc      4860
     acaatgccgt tcttattctg taacatcaat aatgtatgta actttgcatc acgaaatgat      4920
     tattcatact ggctgtcaac accagctctg atgccaatgg acatggctcc aattagtggc      4980
     agagctctcg aaccctatat tagcagatgc accgtctgtg aaggtccagc aatggccata      5040
     gctgttcaca gtcaaactac tgctatccct ccgtgtcccc aggactgggt ttctctctgg      5100
     aaaggttttt ctttcattat gttcacaagt gcaggctctg agggtgctgg acaagcactt      5160
     gcctcgcctg gctcctgcct ggaagaattc cgagccagtc catttataga atgccatgga      5220
     cgagggacat gtaactacta ctcaaactcc tacagtttct ggctggcttc gctgaaccca      5280
     gaaagaatgt tcagaaaacc tattccatca actgtgaaag ctggagactt agagaaaatc      5340
     ataagccgct gtcaggtgtg catgaagaaa agacattgac gaaatcaaag aaaccagaac      5400
     cgtttttttt tttttttttt tttttttttg ttccttctta agtaacaaag tcatgactta      5460
     gaacatgaat ttacttaggt ctttctctct aaccttaaag atgtagtagt gcaaagtttc      5520
     actacacaag aaagcatttc attcgttagt ctgtgatgtg ggtctctaaa cctgtaggtt      5580
     tcaaagttcc ctgtggaaag gcaacagctt gccacagaat atcgctgaaa tcacattcca      5640
     gttgtaccca aagagctgac taaatgttga ttgtgtggaa cttgaactac aagctaagag      5700
     aggtctgtcc tgtggatgca cggtgtgttc cttgtctccc actcctgagc aaaggagtgc      5760
     ggttccttcc atctcctccc tgacacctta gacttcaact acagaaggag aagggagtat      5820
     accatcaagc acaccgtgaa gagaactgga gggtcagagc tgctgagtgg tgtaagggct      5880
     agaacacaga ataaatgagg ccccatgatg tttcaggact catttaaata tgcacaaggc      5940
     taggaccaaa ggaaacttcc tgaagcgaat cataacaggc ttgtatataa agtgtagttt      6000
     tgttttctgt tttgttgacg atgtctattt gcttattcac tgagctcttt ttactatgtc      6060
     aatagattca aagctggtaa aacgtttacc cttggggaac taggttttac taggatggca      6120
     tacacataca ttgaaacatt tctctttatt gttttcacaa gtaacaagga cactgcttac      6180
     taaatgtgca ctttatcccc actcctatca acgccgacct taaataattt caccaggaaa      6240
     taatcaggtt tatccgacgc aaacattttt ttctttgctc taaacagtac ataacatggc      6300
     atttacagat ttgttccttt gttagtttta taacttttcc tttggaaaac acacacgtac      6360
     gccatgattt ttatgttata gattcttcgc aaccatgtgg aaagagacca ctgggtaaaa      6420
     ccttactgta ctgtacacag ctgctatatg tcttaaaaca tgttcttaag tatacagata      6480
     cattccacag ttacttaatt gagcttaaca agttgttttc ttcagttcca aactatttcc      6540
     catatactgg actggaccgg cggtgcaggg ggtagtgaga gagacttgct tctgatctac      6600
     cctcaaagga gataacaaac cccgtgtgtg gagactctca cgcaggcagg aagcccatcc      6660
     tctgctgctt cacccccttc cctacacgga aaacaaacaa agagtctcag ctatggttgc      6720
     tgttttagtt ttcccttact tctatttcac agttcagcag gcctgagaga agatttaaaa      6780
     ataagagcac ttgttgctct gcagaagccc ctagtttagt tcctagtacc cacactggta      6840
     ctgtttcaca gtagcctctt ccagatgacc caacatccac ttctggactc tgcacccacg      6900
     ctcagctaga tatacaaaag ttttaaaact tttaaaataa gatctatgtc caggctaagt      6960
     tcaaaacctc taacttctct taggcatgcc agaagctaat gtctgaaaaa tattaagaaa      7020
     tcgggaactt tttaataatc agatagtgtc gtactatttg aagactcaaa gaggccaggc      7080
     attgtgaggc aaacctttga gtgtatttct tgacccacgg aagtggacgt gatggtgctg      7140
     atacttaagt tcaggctggt gctgtaaact caactgcttt gtatttggaa aatgtgaccc      7200
     aagagcacag acaagggttg tcattcttta ccattcgtgt gaccactaca agacatttta      7260
     cacctgagct gagacatgca acatctcatt acaagtatgt atttcagcta acatttttgt      7320
     ttgaaaaata tcctgttgtc ccacatacat tccagtagtg aaaacaagga ctaatctcct      7380
     tggccagtgt aggagtagca gctgtggcat tcaggagctt gtcctaattg cccattgtag      7440
     atcattctaa acctgcaaag tttgaaactg taactagcaa acagaaatct gtgtcttgtc      7500
     ttgatgagaa gcatctcatt gtacaaccca ggatgacccc caaatcacca caagttttct      7560
     gcctcagcca cccagaattt tgttttcaaa gttttcatca tcctctcatg ttctccactc      7620
     aataggcaca cacccaagaa actggccaca atccttttca cctttgtctc tctttaaaac      7680
     tcactggtga ctttcagggt aatctatttc actactagac tggtgctgat gtcacaacag      7740
     ctacccttca tttgctcata ggccc                                            7765
//