Dbfetch

ID   AF164785; SV 1; linear; genomic DNA; STD; MUS; 1278 BP.
XX
AC   AF164785;
XX
DT   24-AUG-2002 (Rel. 72, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus semaphorin H precursor gene, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1278
RA   Raper J.A., Renzi M.J., Feiner L.;
RT   ;
RL   Submitted (01-JUL-1999) to the INSDC.
RL   Department of Neuroscience, University of Pennsylvania, 423 Curie Blvd.,
RL   Philaldephia, PA 19104, USA
XX
DR   MD5; c6ad5a061e52856d545cf59fa6977d0f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1278
FT                   /organism="Mus musculus"
FT                   /strain="129/Sv"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(<40..154,259..>328)
FT                   /product="semaphorin H precursor"
FT   CDS             join(<40..154,259..>328)
FT                   /codon_start=1
FT                   /product="semaphorin H precursor"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR015513"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K4M3"
FT                   /protein_id="AAM96213.1"
FT                   /translation="NDMGGQRILVNKWSTFLKARLVCSVPGMNGIDTYFDELEDVFLLP
FT                   TRDPKNPVIFGLFNTT"
XX
SQ   Sequence 1278 BP; 328 A; 231 C; 232 G; 430 T; 57 other;
     gnaatnnncc nntncttgtt tgtcnttttg tttttacaga atgacatggg aggacagaga        60
     atcctggtga acaagtggag cactttcctt aaagcgcggc tggtttgctc agtgccggga       120
     atgaatggaa tcgacacata ctttgacgaa ctaggtaaca attactggag gaactaattt       180
     gtttaaacaa ttacattttc tttgcatgaa tcgaaggtta aaaatccaaa atgatgggat       240
     ggttttttat tctttcagag gatgtgtttt tactgccgac cagagatcct aagaatccag       300
     tgatatttgg actgtttaat actaccaggt gagaaattta tagtcagtaa aacacaatag       360
     aagatttgtc acactgtagt tcctttcatg gtgtacatta gtcagaaaca ctgctgagcc       420
     ccttgtcatg cccatcctct ctctgcagct ttaagtgtct ggcttctctt tctttcaccg       480
     gactgcagct gtctgtcttt cagcttcaaa gctacaatct aaatctagac cttattgttt       540
     tgtttgtaac atcctggcat cctcatacaa ccacactccc aatcccttta attactcatg       600
     ggcaaccatt tgacactttt gattggtcgt tatgagatat tacttgtaca ctgtcaggtc       660
     taangggtaa ttttttaatt tatttctcag atgaaaattt ccaatccatt ccggctttca       720
     aagtgctctg gtaactgttc aacttcaagt ttggggaagg ttttttggtt ggtttggttt       780
     gnttggttng gtttttnaat ctaatgaatt ttttctcatg gcaaaataaa taccccttng       840
     gcaagaatct tcaacanttt accattgggc aggttcttaa ccattggaat ctttnaattt       900
     acctgggtac ctggttggna aatggacttt tncccgttcc aactttnagt ttatggtcaa       960
     tngcttatga aaatggtnaa aaagtnttct ttnaanttca ccctggangg aaaatggtng      1020
     gccttttgan ggcttaactg gnttnccttt ccggttagcc ctaaggccct aanttcttgg      1080
     gaaacctttc caagncnttn aaaancaaat nttanacttn ggncctaaaa aaggttttna      1140
     aacccttaac tggtnnaaat aaaggntncc ccntttntat aagctntttt ggggcctctn      1200
     gggnaaaatt gtnnntttaa ancccttttc aaaaatgacc taatttnaaa tnnggggttt      1260
     ttttnaaaat tnttcncg                                                    1278
//