spacer

EBI Dbfetch

ID   AF164346; SV 1; linear; genomic DNA; STD; HUM; 269 BP.
XX
AC   AF164346;
XX
DT   09-AUG-1999 (Rel. 60, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens isolate NT0003 MHC class II antigen (HLA-DRB1) gene,
DE   HLA-DRB1*1337 allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-269
RA   Hurley C.K., Tang T.F., Lin Y.S.;
RT   "Human Leukocyte Antigen Class II DRB1*13 new allele";
RL   Unpublished.
XX
RN   [2]
RP   1-269
RA   Hurley C.K., Tang T.F., Lin Y.S.;
RT   ;
RL   Submitted (30-JUN-1999) to the INSDC.
RL   Microbiology & Immunology, Georgetown University, 3970 Reservoir Rd,,
RL   Washington, DC 20007, USA
XX
DR   MD5; 632d0d9fadc8cb5e6ff62fe4332e4b3d.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..269
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="NT0003"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRB1*08041, *13new; DRB3*0202"
FT                   /tissue_type="umbilical cord blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>269
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            1..269
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>269
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:37"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAD47814.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEDKRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 269 BP; 59 A; 64 C; 95 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacaag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacggtg cagcggcga                                         269
//


spacer
spacer