Dbfetch

ID   AF161699; SV 1; linear; mRNA; STD; MUS; 1271 BP.
XX
AC   AF161699;
XX
DT   22-JUL-1999 (Rel. 60, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus APOBEC-2 (Apobec2) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1271
RX   DOI; 10.1006/bbrc.1999.0925.
RX   PUBMED; 10403781.
RA   Liao W., Hong S.H., Chan B.H., Rudolph F.B., Clark S.C., Chan L.;
RT   "APOBEC-2, a cardiac- and skeletal muscle-specific member of the cytidine
RT   deaminase supergene family";
RL   Biochem. Biophys. Res. Commun. 260(2):398-404(1999).
XX
RN   [2]
RP   1-1271
RA   Liao W., Chang B.-J., Chan L.;
RT   ;
RL   Submitted (22-JUN-1999) to the INSDC.
RL   Cell Biology, Baylor College of Medicine, One Baylor Plaza, Houston, TX
RL   77030, USA
XX
DR   MD5; 0abb5a5327cdfd470b4bb090822d1f3f.
DR   Ensembl-Gn; ENSMUSG00000040694; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046549; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1271
FT                   /organism="Mus musculus"
FT                   /chromosome="17"
FT                   /mol_type="mRNA"
FT                   /tissue_type="heart"
FT                   /db_xref="taxon:10090"
FT   CDS             121..795
FT                   /codon_start=1
FT                   /gene="Apobec2"
FT                   /product="APOBEC-2 protein"
FT                   /note="cardiac and skeletal muscle specific cytidine
FT                   deaminase; cytidine deaminase supergene family member"
FT                   /db_xref="GOA:Q9WV35"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR013158"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="MGI:MGI:1343178"
FT                   /db_xref="PDB:2RPZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WV35"
FT                   /protein_id="AAD45361.1"
FT                   /translation="MAQKEEAAEAAAPASQNGDDLENLEDPEKLKELIDLPPFEIVTGV
FT                   RLPVNFFKFQFRNVEYSSGRNKTFLCYVVEVQSKGGQAQATQGYLEDEHAGAHAEEAFF
FT                   NTILPAFDPALKYNVTWYVSSSPCAACADRILKTLSKTKNLRLLILVSRLFMWEEPEVQ
FT                   AALKKLKEAGCKLRIMKPQDFEYIWQNFVEQEEGESKAFEPWEDIQENFLYYEEKLADI
FT                   LK"
XX
SQ   Sequence 1271 BP; 367 A; 320 C; 319 G; 265 T; 0 other;
     gaattccgtg ctctctctgt catccccagc caggcttagc tgctgacagc tgcttgggac        60
     tctgccgcca ggcccttggc tggcttgaca acctctccac atttcggcca cagttcctcc       120
     atggctcaga aggaagaggc cgctgaggct gcggcgccag cctctcagaa tggagatgat       180
     ttggagaacc tggaagaccc tgagaagctg aaagagctga tcgatcttcc gcccttcgag       240
     attgtcactg gggtgcggct accagtcaac ttcttcaagt ttcagttccg gaacgtggaa       300
     tacagttccg ggcggaataa gacctttctc tgctatgtgg tcgaagtaca gagtaagggc       360
     ggccaagcgc aggcgacgca gggctacctg gaggatgaac acgcaggtgc ccacgccgag       420
     gaggctttct ttaacaccat cctgccagct ttcgacccgg ccctcaagta caacgtcacc       480
     tggtatgtgt cctccagccc ctgtgcagcc tgcgctgacc ggattctcaa aaccctcagc       540
     aagaccaaga accttcgtct gctcatcctg gtgagccggc tcttcatgtg ggaggagcca       600
     gaggtccagg ccgctctgaa aaagctgaag gaggccggct gcaaacttcg catcatgaaa       660
     ccccaggact tcgagtacat ctggcagaat tttgtggagc aagaagaggg tgaatccaag       720
     gcctttgagc cctgggagga cattcaggag aacttcctat actatgagga gaagttggca       780
     gacatcctga agtaggcaac agagctcggc cttccagttt tacctgctgc cactcagagc       840
     aatgacccgg atgccatcca ggacatacct ggcttcctga ttctacttgg agttggacat       900
     ctgacactaa ccagttgcac tggacaagac cctctctcag agaactcaaa acatacctcg       960
     ggacgtcatt cattcattca atcatgcctt ctgtaatacg gctatcagaa gaaggaaaat      1020
     gaagacaaga aaaacaactg tgatgtgggc agcaggtacc tgggggtgga gggtcttatt      1080
     gcctctccag gggtgctgcc tgagacaaag atcctcagtc aaggtacaga cctttgaaat      1140
     acagctagaa aagtgttctg aattgggctg actttttaaa aaagacaaaa tagcaacatc      1200
     aataaaggaa ataagtggta aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1260
     aaaaaaaaaa a                                                           1271
//