spacer

EBI Dbfetch

ID   AF161587; SV 1; linear; mRNA; STD; MUS; 565 BP.
XX
AC   AF161587;
XX
DT   09-AUG-1999 (Rel. 60, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus GABA-A receptor-associated protein (Gabarap) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-565
RA   Wang H., Olsen R.W.;
RT   "Mouse GABARAP cDNA";
RL   Unpublished.
XX
RN   [2]
RP   1-565
RA   Wang H., Olsen R.W.;
RT   ;
RL   Submitted (23-JUN-1999) to the INSDC.
RL   Department of Molecular and Medical Pharmacology, UCLA, 10833 Laconte, Los
RL   Angeles, CA 90095, USA
XX
DR   MD5; 53813d336f48fe16548342e25bca9218.
DR   Ensembl-Gn; ENSMUSG00000018567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018711; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..565
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             64..417
FT                   /codon_start=1
FT                   /gene="Gabarap"
FT                   /product="GABA-A receptor-associated protein"
FT                   /note="GABARAP"
FT                   /db_xref="GOA:Q9DCD6"
FT                   /db_xref="InterPro:IPR004241"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1861742"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCD6"
FT                   /protein_id="AAD47642.1"
FT                   /translation="MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLD
FT                   KKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFF
FT                   LYIAYSDESVYGL"
XX
SQ   Sequence 565 BP; 129 A; 159 C; 136 G; 141 T; 0 other;
     ggccccgtcc cggcccccct gggttccctc agcccagctc ggtccagccc ggttctcggg        60
     agaatgaagt tcgtgtacaa agaggagcat ccgttcgaga agcgccgctc tgagggcgag       120
     aaaatccgaa agaaataccc agaccgggtc ccggtgatag tggaaaaagc ccccaaagct       180
     cggataggag acctggacaa aaagaaatac ctggtgcctt ctgatcttac agttggtcaa       240
     ttctacttct tgatccggaa gcgaattcat ctccgtgctg aagatgcctt gtttttcttt       300
     gtcaacaatg tcattccacc caccagtgcc acgatgggtc agctgtacca ggaacaccat       360
     gaagaagact tctttctata cattgcctac agtgatgaaa gcgtctatgg tctgtgaagc       420
     tgctgtacct gaggtggggg gttccattct acgaagagag gtggcgctcc ttccttgaca       480
     tccagttcct ccttcaggct caaacaccac ctcctttctt caggacctgc acttaatgtt       540
     tgtggctttc tctccagcct ctctt                                             565
//


spacer
spacer