Dbfetch

ID   AF156099; SV 2; linear; mRNA; STD; MUS; 1535 BP.
XX
AC   AF156099;
XX
DT   21-JUN-1999 (Rel. 60, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus glycogen synthase kinase 3 beta mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1535
RA   Salameh W.A., Guo T.B., Chan K.C., Mitchell A.P.;
RT   "Testicular expression and hormonal control of glycogen synthase kinase 3,
RT   a homologue of yeast RIM11";
RL   Unpublished.
XX
RN   [2]
RP   1-1535
RA   Salameh W.A., Guo T.B., Chan K.C., Mitchell A.P.;
RT   ;
RL   Submitted (02-JUN-1999) to the INSDC.
RL   Division of Endocrinology, Department of Medicine, Harbor-UCLA Medical
RL   Center, 1000 West Carson Street, Torrance, CA 90502, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1535
RA   Salameh W.A., Guo T.B., Chan K.C., Mitchell A.P.;
RT   ;
RL   Submitted (24-FEB-2000) to the INSDC.
RL   Division of Endocrinology, Department of Medicine, Harbor-UCLA Medical
RL   Center, 1000 West Carson Street, Torrance, CA 90502, USA
XX
DR   MD5; 7fb22c5cde7fe77e1fcc138d37981838.
DR   Ensembl-Gn; ENSMUSG00000022812; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022808; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022773; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022745; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022774; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022538; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023221; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022064; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022509; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022641; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022616; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022709; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022635; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023236; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021804; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022108; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000023507; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0044379; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0044354; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0044328; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0044330; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0044072; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0044811; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0044182; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0043986; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0044137; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0044092; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0044211; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0044071; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0044870; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0043765; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0043445; mus_musculus_wsbeij.
XX
CC   On Feb 24, 2000 this sequence version replaced gi:5070699.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1535
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             167..1429
FT                   /codon_start=1
FT                   /product="glycogen synthase kinase 3 beta"
FT                   /note="mGSK3beta"
FT                   /db_xref="GOA:Q9WV60"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033573"
FT                   /db_xref="MGI:MGI:1861437"
FT                   /db_xref="PDB:4NU1"
FT                   /db_xref="PDB:5AIR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WV60"
FT                   /protein_id="AAD39258.2"
FT                   /translation="MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPG
FT                   QGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKL
FT                   DHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMY
FT                   QLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYY
FT                   RAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQI
FT                   REMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFF
FT                   DELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASD
FT                   TNAGDRGQTNNAASASASNST"
XX
SQ   Sequence 1535 BP; 465 A; 371 C; 351 G; 348 T; 0 other;
     cttaaatagc tatacaaaag gagtgaaaag ccaagagaac gaagtctttc tttctctttc        60
     ttgcgggaga acttaatgct gcatttatca ttaacctagc accctaacat aaaacaaaag       120
     gaagaaaagg attaaggaag gaaaaggtga ttcaagaaga gccatcatgt cggggcgacc       180
     gagaaccacc tcctttgcgg agagctgcaa gccagtgcag cagccttcag cttttggtag       240
     catgaaagtt agcagagata aagatggcag caaggtaacc acagtagtgg caactcctgg       300
     ccagggtcct gacaggccac aggaagtcag ttatacagac acgaaagtga ttggaaatgg       360
     atcatttggt gtggtatatc aagccaaact ttgtgattct ggagaactgg ttgccatcaa       420
     gaaagttcta caggacaagc gatttaagaa ccgagagctc cagatcatga gaaagctaga       480
     ccactgtaac atagtccgac tgcggtattt cttctactcg agtggtgaga agaaagatga       540
     ggtctacctt aacctggtgc tggactatgt tccggagaca gtgtacagag tcgccagaca       600
     ctatagtcga gccaagcaga cactccctgt gatctatgtc aagttgtata tgtatcagct       660
     gttcagaagt ctagcctata tccattcctt tggaatctgc catcgagaca ttaaaccaca       720
     gaacctcttg ttggatcctg atacagctgt attaaaactc tgtgactttg gaagtgcaaa       780
     gcagctggtc cgaggagagc ccaatgtttc atatatctgt tctcggtact acagggcacc       840
     agagttgatc tttggagcca ctgattacac gtccagtata gatgtatggt ctgcaggctg       900
     tgtgttggct gaattgttgc taggacaacc aatatttcct ggggacagtg gtgtggatca       960
     gttggtggaa ataataaagg tcctaggaac accaacaagg gagcaaatta gagaaatgaa      1020
     cccaaattat acagaattca aattccctca aatcaaggca catccttgga caaaggtctt      1080
     ccggccccga actccaccag aggcaattgc actgtgcagc cgtctgctgg agtacacacc      1140
     taccgcccgg ctaacaccac tggaagcttg tgcacattca tttttcgatg aattgcggga      1200
     cccaaatgtc aaactaccaa atgggcgaga cacacctgca ctcttcaact ttaccactca      1260
     agaactgtca agtaaccccc ctctggccac catccttatc cctccacatg ctcggattca      1320
     ggccgctgct tcaccgcctg ccaacgccac agcagcctca gatactaatg ctggagaccg      1380
     tggacagacc aataacgccg cttctgcatc agcttccaac tccacctgaa cagcccccag      1440
     gagccagctg cgcgggaaag accagcactt acttgagtgc cactcagcaa cactggtcac      1500
     gtttggaaag aaaattaaaa gaaaacaaaa aaaaa                                 1535
//