spacer

EBI Dbfetch

ID   AF153084; SV 1; linear; mRNA; STD; MUS; 948 BP.
XX
AC   AF153084;
XX
DT   01-JUN-1999 (Rel. 59, Created)
DT   01-JUN-1999 (Rel. 59, Last updated, Version 1)
XX
DE   Mus musculus sprouty-2 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-948
RX   DOI; 10.1016/S0960-9822(99)80094-3.
RX   PUBMED; 10074434.
RA   Tefft J.D., Lee M., Smith S., Leinwand M., Zhao J., Bringas P.Jr.,
RA   Crowe D.L., Warburton D.;
RT   "Conserved function of mSpry-2, a murine homolog of Drosophila sprouty,
RT   which negatively modulates respiratory organogenesis";
RL   Curr Biol 9(4):219-222(1999).
XX
RN   [2]
RP   1-948
RA   Tefft J.D., Lee M., Smith S., Leinwand M., Zhao J., Bringas P.Jr.,
RA   Crowe D.L., Warburton D.;
RT   ;
RL   Submitted (20-MAY-1999) to the INSDC.
RL   Dentistry, USC, 2250 Alcazar St. CSA 103, Los Angeles, CA 90033, USA
XX
DR   MD5; 3e6d1e825fa8dd6df091870fd349388d.
DR   Ensembl-Gn; ENSMUSG00000022114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022709; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..948
FT                   /organism="Mus musculus"
FT                   /strain="Swiss Webster"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..948
FT                   /codon_start=1
FT                   /product="sprouty-2"
FT                   /db_xref="GOA:Q9QXV8"
FT                   /db_xref="InterPro:IPR007875"
FT                   /db_xref="MGI:MGI:1345138"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QXV8"
FT                   /protein_id="AAD34167.1"
FT                   /translation="MEARAQSGNGSQPLLQTAHDSGRQRGEPDPRDALTQQVHVLSLDQ
FT                   IRAIRNTNEYTEGPTVVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQPSQVHSSRA
FT                   PLSRSISTVSSGSRSSTRTSTSSSSSEQRLLGPSFSHGPAAADGIIRVQPKSELKPGDI
FT                   KPLSKDDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCV
FT                   KGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQG
FT                   CYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT"
XX
SQ   Sequence 948 BP; 213 A; 271 C; 257 G; 207 T; 0 other;
     atggaggcca gagctcagag tggcaacggg tcgcagcctt tgctgcagac agcccatgac        60
     agtggcaggc agcgcgggga gccggatcca agagatgccc ttacccagca ggtacacgtc       120
     ttgtctctgg atcagatcag agccatccga aacaccaatg agtacacaga gggccctact       180
     gtggtcccaa gacctgggct caagcctgct cctcgcccct ccactcagca caaacatgaa       240
     agactccacg gtctgccgga gcaccgccag cctcccaggc tccagccctc gcaggtccat       300
     tcttcacggg cccctctgtc caggtccatc agcactgtca gctcagggtc tcggagcagt       360
     acaaggacaa gtaccagcag cagctcctcg gaacagagac tgttaggacc gtccttctcc       420
     cacgggcctg ctgctgctga tggaataatc cgagtgcagc ctaaatcgga gctcaagcct       480
     ggtgacatta agccactgag caaggatgat ttgggtctgc atgcctacag gtgtgaggac       540
     tgtggcaagt gcaagtgtaa ggagtgcacc tacccgaggc ccctgccgtc ggactggatc       600
     tgtgacaagc agtgcctctg ctcagcccag aacgtcattg actatgggac ttgtgtgtgc       660
     tgtgtgaaag gtctcttcta tcactgctcc aatgacgatg aggacaattg tgctgacaac       720
     ccgtgctctt gcagccagtc ccattgttgt acgcgatggt cagcgatggg agtcatgtct       780
     ctctttttgc cttgtttatg gtgttacctt ccagccaagg gttgccttaa attgtgccag       840
     gggtgttatg accgagtgaa caggccgggt tgtcgttgta aaaactcaaa tacagtttgc       900
     tgcaaagttc ccactgtccc ccctaggaac tttgaaaagc cgacatag                    948
//


spacer
spacer