Dbfetch

ID   AF152843; SV 1; linear; genomic DNA; STD; HUM; 234 BP.
XX
AC   AF152843;
XX
DT   22-JUL-1999 (Rel. 60, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*03011 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-234
RA   Eberle M., Asu U., Taylor M., Hunter J.B., Fuller T.C., Maurer D.;
RT   "Identification of a Putative DR8 Founder Haplotype Containing a Novel
RT   DRB1*0801 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-234
RA   Fuller T.C., Taylor M.R., Spangler F.;
RT   ;
RL   Submitted (20-MAY-1999) to the INSDC.
RL   H&I Laboratory, University of Utah Health Sciences Center, 50 North Medical
RL   Drive, Salt Lake City, UT 84132, USA
XX
DR   MD5; a327692bb5506f5aa1a1b193e00fa8ff.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..234
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>234
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            <1..>234
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>234
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9TQ23"
FT                   /db_xref="IMGT/HLA:DRB1*03:01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TQ23"
FT                   /protein_id="AAD45284.1"
FT                   /translation="ECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDA
FT                   EYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTV"
XX
SQ   Sequence 234 BP; 53 A; 54 C; 88 G; 39 T; 0 other;
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggtacc tggacagata cttccataac        60
     caggaggaga acgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       120
     gggcggcctg atgccgagta ctggaacagc cagaaggacc tcctggagca gaagcggggc       180
     cgggtggaca actactgcag acacaactac ggggttgtgg agagcttcac agtg             234
//