Dbfetch

ID   AF146344; SV 1; linear; mRNA; STD; MUS; 2749 BP.
XX
AC   AF146344;
XX
DT   05-MAY-2000 (Rel. 63, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus CD97 antigen (Cd97) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2749
RX   DOI; 10.1046/j.1365-2567.1999.00859.x.
RX   PUBMED; 10540231.
RA   Qian Y.M., Haino M., Kelly K., Song W.C.;
RT   "Structural characterization of mouse CD97 and study of its specific
RT   interaction with the murine decay-accelerating factor (DAF, CD55)";
RL   Immunology 98(2):303-311(1999).
XX
RN   [2]
RP   1-2749
RA   Qian Y.M., Haino M., Kelly K., Song W.C.;
RT   ;
RL   Submitted (27-APR-1999) to the INSDC.
RL   Center for Experimental Therapeutics and Pharmacology, Univ. of
RL   Pennsylvania, 422 Curie Blvd., Philadelphia, PA 19104, USA
XX
DR   MD5; e2b497fac2eb3c40971f21ef81e72a70.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2749
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             46..2220
FT                   /codon_start=1
FT                   /gene="Cd97"
FT                   /product="CD97 antigen"
FT                   /db_xref="GOA:Q9Z0M6"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000203"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR003056"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="MGI:MGI:1347095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z0M6"
FT                   /protein_id="AAF67800.1"
FT                   /translation="MRGVRCPGLLVVCILLSLSGAGTQKAESKNCAKWCPINSKCVSNR
FT                   SCVCKPGFSSEKELITNPAESCEDINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYKLL
FT                   SGAESFVNESENTCQDVDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKPTSGSLRGPD
FT                   TICQEPPFPTWTLLPTAHSQTLLRFSVEVQNLLRDFNPATVNYTIQKLIEAVDKLLEDP
FT                   METQTQQVAAQLLSNLEQSLRTLAQFLPKGPFTYTSPSNTELSLMVKEQDNKDVTTVHH
FT                   GQTWMELDWAVTAGAKISENGSSVAGILSSPNMEKLLGNTPLNLEQRRASLEDFYGSPI
FT                   PSVSLKLLSNINSVFLTNTNTEKLASNVTFKFDFTSVESIEPRHELICAFWKAHNGNGY
FT                   WDTDGCSMNGTGSCHCNHLTSFAILMAQYHVQDPRLELITKVGLLLSLICLLLCILTFL
FT                   LVKPIQSSRTMVHLHLCICLFLGSIIFLVGVENEGGEVGLRCRLVAMMLHFCFLAAFCW
FT                   MALEGVELYFLVVRVFQGQGLSTWQRCLIGYGVPLLIVAISMAVVKMDGYGHATYCWLD
FT                   FRKQGFLWSFSGPVAFIIFCNAAIFVITVWKLTKKFSEINPNMKKLRKARVLTITAIAQ
FT                   LLVLGCTWGFGLFLFNPHSTWLSYIFTLLNCLQGLFLYVMLCLLNKKVREEYWKWACMV
FT                   TGSKYTEFNSSTTGTGTSQTRALRSSESGM"
XX
SQ   Sequence 2749 BP; 661 A; 771 C; 690 G; 627 T; 0 other;
     cgccctggca ggtcccagac gctgtccgtt ccgtgccgcg ccaccatgag gggcgtcaga        60
     tgccccggcc tgcttgtggt gtgcatttta ctgagtctct caggagctgg aacccagaag       120
     gcagagagta agaactgtgc caagtggtgc cctatcaact caaaatgtgt cagtaacaga       180
     agctgtgtct gcaagcccgg cttcagctcg gagaaggaat tgatcactaa ccctgcagag       240
     agctgtgaag acatcaacga gtgtttacta cctggatttt cctgtggaga ctttgccatg       300
     tgtaagaact cagaggggag ttacacctgc gtctgtaacc tgggatataa gctcctttct       360
     ggtgcagaat cttttgttaa cgagagtgag aatacatgtc aagatgtgga tgagtgcagc       420
     tctgggcagc atcaatgtca caattccacc gtctgcaaaa acaccgtagg ctcctacaag       480
     tgccactgcc gtccaggttg gaagccaact tctgggtccc tccgtggtcc agacaccata       540
     tgccaagagc caccgttccc tacttggaca ctgctgccca cagcccacag tcagactctc       600
     ttgagattct ctgttgaagt ccagaatctg ctccgagact tcaatccagc cacggtcaac       660
     tacaccatcc agaaactcat cgaggctgtg gacaagctgc tggaagaccc catggagact       720
     caaacccaac aagtagctgc ccagttgctc tcgaacctgg aacaaagcct tcggaccttg       780
     gcccagttct tacccaaagg ccccttcacc tacacgtccc cttcaaatac tgaactgtcc       840
     ctgatggtga aggagcaaga caacaaagat gttaccacag tgcaccacgg ccaaacttgg       900
     atggagctgg actgggctgt gacagctgga gccaaaatct cagaaaatgg ctcctcggtg       960
     gcaggcatcc tgtccagccc aaacatggaa aagctgctgg gcaacacccc gctgaacttg      1020
     gagcagagaa gggcctcctt ggaggacttc tatggaagcc cgattccgag cgtctcactt      1080
     aaacttctct caaacatcaa ttctgtcttc ctgaccaaca cgaacactga gaagcttgcc      1140
     tcgaatgtca cgttcaagtt cgactttact tctgtggagt caattgagcc acgtcacgag      1200
     ttgatatgtg ccttctggaa agcccacaac gggaatgggt actgggacac cgacggctgc      1260
     tcaatgaatg gcactggctc ctgccactgc aaccacctga ccagctttgc catcctaatg      1320
     gctcagtacc atgtgcagga cccaaggctg gaattgatca ccaaggtggg gctgttgttg      1380
     tccctgatct gcctgctgct gtgcatcctg accttcctgc tggtgaagcc catccagagc      1440
     tctcgaacca tggtgcacct gcacctgtgc atctgcctct tcctgggctc aatcatattc      1500
     ctggtcggcg tggagaatga agggggtgag gtgggcctgc gctgccgcct ggtggccatg      1560
     atgctgcatt tctgcttcct ggccgccttc tgctggatgg cactggaggg cgtggagctc      1620
     tacttcctgg tggtgcgtgt gttccagggc caaggcctga gtacatggca acgctgcctg      1680
     attggctacg gggtgcccct cctcatcgtg gccatctcaa tggcagttgt caaaatggat      1740
     ggctatgggc atgcaacata ctgctggctg gactttagga agcagggctt tctctggagc      1800
     ttttcgggac ccgtggcctt catcattttc tgcaatgctg ccattttcgt gatcactgtc      1860
     tggaagctca caaagaagtt ttctgaaatc aacccaaaca tgaagaagtt aaggaaggcg      1920
     agggtgctga ccatcaccgc catcgcccag ctccttgtgc tgggctgcac ctggggcttc      1980
     ggcctgttcc tcttcaaccc ccatagcaca tggctatcct acatctttac cctgctcaac      2040
     tgcctgcagg gcctattcct ctatgtgatg ctctgcctgc tcaacaaaaa ggtgagggaa      2100
     gagtactgga aatgggcctg catggtcact gggagcaagt acacagagtt caactcttcc      2160
     acaacaggca ctggcaccag ccaaacacgg gctctcaggt cctcagaatc agggatgtga      2220
     aggcgagttc catgaaggac agcagcacat actcacggct gtcatcctgc cttctgttcc      2280
     tgccaccttt ctgcctttga ccccacttca tataaagaag ggatgcaaac ccagcaatga      2340
     gccctgccac ggggcaaggg gtcgctggtc ctgcttctgg ttgtctctgc ctcaccacag      2400
     ctactgccta ccagagaaac agaatgcagc cagcccagac ctgcagccca ctgcctggta      2460
     cacgaggcag gcagtcctag gacaaaggga aagcccttga gacctgggct ctttgccagg      2520
     gtgctgggtt cagtttcctt aagctaagac tgtggatgcc acgtcagcca ctgaagcccg      2580
     cctgctgctg aggctcacgg tacaaggcct cgctgctcca catccagggc aaaggtctca      2640
     cagctaaaga ctaggttttg taattttttt aacctgtaaa cctttcaatg ttgacacaca      2700
     aaattaaata tcatattgat aaaaaaaaaa aaaaaaaaaa aaaaaaaaa                  2749
//