Dbfetch

ID   AF145922; SV 1; linear; mRNA; STD; MUS; 3803 BP.
XX
AC   AF145922;
XX
DT   21-DEC-1999 (Rel. 62, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus serine/threonine kinase UNC51.2 (Unc51.2) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3803
RX   DOI; 10.1016/S0896-6273(00)81031-4.
RX   PUBMED; 10624947.
RA   Tomoda T., Bhatt R.S., Kuroyanagi H., Shirasawa T., Hatten M.E.;
RT   "A mouse serine/threonine kinase homologous to C. elegans UNC51 functions
RT   in parallel fiber formation of cerebellar granule neurons";
RL   Neuron 24(4):833-846(1999).
XX
RN   [2]
RP   1-3803
RA   Tomoda T.;
RT   ;
RL   Submitted (26-APR-1999) to the INSDC.
RL   Laboratory of Developmental Neurobiology, The Rockefeller University, 1230
RL   York Avenue, New York, NY 10021-6399, USA
XX
DR   MD5; 06dccf8ff8e432c38d9897a0c05c17f7.
DR   Ensembl-Gn; ENSMUSG00000004798; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018447; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018416; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018386; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018387; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018200; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018839; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017757; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018174; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018283; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018274; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018356; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018298; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018880; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017530; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017809; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000004920; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0029595; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0029546; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0029520; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0029539; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0029338; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0030038; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0029031; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0029254; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0029399; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0029373; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0029508; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0029359; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0030073; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0028738; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0028828; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3803
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="day 6 postnatal"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             410..3523
FT                   /codon_start=1
FT                   /gene="Unc51.2"
FT                   /product="serine/threonine kinase UNC51.2"
FT                   /note="Caenorhabditis elegans UNC-51 homolog"
FT                   /db_xref="GOA:Q9QY01"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016237"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR022708"
FT                   /db_xref="MGI:MGI:1352758"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QY01"
FT                   /protein_id="AAF18325.1"
FT                   /translation="MEVVGDFEYCKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKN
FT                   LSKSQILLGKEIKILKELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLS
FT                   EDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLSYANRRKSNVSGIRIKIADFGFAR
FT                   YLHSNTMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDL
FT                   RMFYEKNRSLMPSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQVPVKKSCP
FT                   VPVPVYSGPVPGSSCSSSPSCRFASPPSLPDMQHIQEENLSSPPLGPPNYLQVSKDSAS
FT                   NSSKNSSCDTDDFVLVPHNISSDHSYDMPMGTTARRASNEFFMCGGQCQPTVSPHSETA
FT                   PIPVPTQVRNYQRIEQNLISTASSGTNPHGSPRSAVVRRSNTSPMGFLRVGSCSPVPGD
FT                   TVQTGGRRLSTGSSRPYSPSPLVGTIPEQFSQCCCGHPQGHEARSRHSSGSPVPQTQAP
FT                   QSLLLGARLQSAPTLTDIYQNKQKLRKQHSDPVCPSHAGAGYSYSPQPSRPGSLGTSPT
FT                   KHTGSSPRNSDWFFKTPLPTIIGSPTKTTAPFKIPKTQASSNLLALVTRHGPAESQSKD
FT                   GNDPRECSHCLSVQGSERHRSEQQQSKAVFGRSVSTGKLSEQQVKAPLGGHQGSTDSLN
FT                   TERPMDVAPAGACGVMLALPAGTAASARAVLFTVGSPPHSATAPTCTHMVLRTRTTSVG
FT                   SSSSGGSLCSASGRVCVGSPPGPGLGSSPPGAEGAPSLRYVPYGASPPSLEGLITFEAP
FT                   ELPEETLMEREHTDTLRHLNMMLMFTECVLDLTAVRGGNPELCTSAVSLYQIQESVVVD
FT                   QISQLSKDWGRVEQLVLYMKAAQLLAASLHLAKAQVKSGKLSPSMAVKQVVKNLNERYK
FT                   FCITMCKKLTEKLNRFFSDKQRFIDEINSVTAEKLIYNCAVEMVQSAALDEMFQQTEDI
FT                   VYRYHKAALLLEGLSKILQDPTDVENVHKYKCSIERRLSALCCSTATV"
XX
SQ   Sequence 3803 BP; 955 A; 1014 C; 956 G; 878 T; 0 other;
     acagcagcgc cgcgggcgca acaagcggag gcagccgcac ctgcggggat ggcgcggccc        60
     cggccctgca ccgctgtcag gcgcgcgggt agctccgggt acgcccagtg acggcggcgg       120
     tgccctcggc cgggcagtgc ccaggccgct tggctagagc cccgcggccg acggcggccc       180
     gggccatgag aagcgaccgg gcccaggcct cgctgacccc ggctccgcgc ggcggcccgt       240
     cccgtttccg ctccggcctc tcggcatgag tgtccatccg ggcccggggc cgtggctgcc       300
     cctgtcccgc cgcccgcggg cgtgcttggg gccctcgggc ccgcggtgct gatcccggtt       360
     ctccgccacg cctgcccacc ctagcgctct atgtcccggg ggcgcggcca tggaggtggt       420
     gggcgacttc gagtactgca agcgggacct cgtgggacac ggggccttcg ctgtggtctt       480
     ccgggggcgg caccgccaga aaactgattg ggaggtggct attaaaagta ttaataaaaa       540
     gaacttgtca aaatcacaaa ttctgcttgg aaaggaaata aaaatcttaa aggagcttca       600
     gcatgaaaac atcgtagcgc tctatgatgt tcaggaattg cccaactctg tctttctggt       660
     gatggagtat tgcaatggtg gagacctggc agattatttg caagctaaag gaactctgag       720
     tgaagatact atcagagtgt ttctccatca gattgcggca gccatgcgaa tcctgcacag       780
     caaagggata atccacaggg atctcaaacc acagaatatc ctgttgtctt atgccaatcg       840
     aaggaagtcg aatgtcagtg gtattcgtat taaaatagct gattttggtt tcgcacggta       900
     cctacatagt aacacaatgg cagcgacact gtgtggatcc ccaatgtaca tggctcccga       960
     ggttattatg tctcaacatt atgatgctaa ggcagattta tggagcatag gaacagtgat      1020
     ctatcaatgc ctagttggaa aaccaccttt tcaggctaat agtcctcagg acctaaggat      1080
     gttttatgaa aaaaacagga gcttaatgcc tagtattccc agagaaacat caccttactt      1140
     ggctaatctc cttttgggtt tgcttcagag aaatcaaaag gatagaatgg actttgaagc      1200
     atttttcagc catcctttcc ttgagcaagt tccagttaaa aaatcttgcc cagtcccagt      1260
     gcctgtgtat tctggccctg tccctggaag ctcctgcagc agctcaccat cttgtcgctt      1320
     tgcttctcca ccatcccttc cagatatgca gcatattcag gaagaaaact tatcctcccc      1380
     accgttgggt cctcccaact atctacaggt gtccaaagac tctgcgagta atagtagcaa      1440
     gaactcttct tgtgacacgg atgactttgt tttggttcca cacaacatct cgtcagacca      1500
     ctcatatgac atgccaatgg ggactacggc cagacgcgct tcaaatgaat tctttatgtg      1560
     tggagggcag tgtcaaccta ctgtgtcacc tcacagcgaa acagccccaa ttccagttcc      1620
     tactcaagta aggaattatc agcgcataga acagaatctt atatccactg ccagctctgg      1680
     cacaaaccca catggttctc caagatctgc agtagtacga aggtctaata ccagccccat      1740
     gggcttcctc cgggttgggt cctgctcccc tgtaccagga gacacagtgc agacaggagg      1800
     acgaagactc tctactggct cttccaggcc ttactcacca tcccccttgg ttggtaccat      1860
     tcctgaacag tttagtcagt gctgctgtgg acatcctcag ggccatgaag ccaggagtag      1920
     gcactcctca ggttctccag tgccacagac ccaggcacca cagtcactct tactgggtgc      1980
     tagactgcag agtgcaccca ccctcaccga tatctatcag aacaagcaga agctcagaaa      2040
     gcagcactct gaccctgtgt gtccgtccca tgctggagct gggtatagtt actcacctca      2100
     gcctagtcgg cctggcagcc ttgggacctc tcccaccaag cacacggggt cctctccacg      2160
     gaattctgac tggttcttta aaactccttt accaacaatc attggctctc ctactaagac      2220
     tacagctcct ttcaaaatcc ctaaaacaca agcatcttct aacctgttag ccttggttac      2280
     tcgtcatggg cctgctgaaa gccagtccaa agatgggaat gaccctcgtg agtgttccca      2340
     ctgcctctca gtacaaggaa gcgagaggca tcgatctgag cagcagcaga gcaaggcagt      2400
     gtttggcaga tctgtcagta ctgggaagtt atcagaacaa caagtaaagg cacctttagg      2460
     tggacaccag ggcagcacgg atagtttaaa cacagaacga ccaatggatg tagctcctgc      2520
     aggagcctgt ggtgttatgc tggcattgcc agcaggaaca gcagcaagcg ccagagctgt      2580
     cctcttcacc gtggggtctc ctccacacag tgccacagcc cccacttgta ctcatatggt      2640
     ccttcgaaca agaaccacct cagtggggtc cagcagctca ggaggttcct tgtgttctgc      2700
     aagtggccga gtatgtgtgg gctcccctcc tggaccaggg ttgggctctt ccccaccagg      2760
     agcagaggga gctcccagcc taagatacgt gccttatggt gcttcaccac ccagcctaga      2820
     gggtctcatc acctttgaag cccctgaact accagaggag acactgatgg agcgagagca      2880
     cacagacacc ttacgccatc tgaacatgat gttaatgttt actgagtgtg tgctggacct      2940
     gacggcagtg aggggtggga accctgagct gtgcacatct gctgtgtcct tgtaccagat      3000
     tcaggagagt gtagttgtgg accagatcag ccagctaagc aaagattggg ggcgggtgga      3060
     gcagctggtg ttgtacatga aggcagcaca gctgctggcg gcttccctgc atctcgccaa      3120
     agctcaggtc aagtctggga agctgagccc atccatggct gtgaaacaag ttgttaaaaa      3180
     tctgaatgaa agatacaaat tctgcatcac catgtgcaag aaacttacag aaaagctgaa      3240
     tcgcttcttc tccgataaac agagatttat tgatgaaatc aacagtgtga ctgcagagaa      3300
     actcatctat aattgtgctg tggaaatggt tcaatctgca gccctggatg agatgtttca      3360
     gcagactgaa gacatcgttt atcgctacca caaggcagcc cttcttttgg aaggcttaag      3420
     taagatcctg caggacccta cagatgttga aaatgtgcat aagtataaat gtagtattga      3480
     aagaagattg tcagcactct gctgtagcac tgcaactgtg tgagtagcag gcttgtccgt      3540
     ggactggcat ggaacaggag gtgatacatt tgggattacg tcttggttct gtcacccatc      3600
     ccaggacagt gtggtgacta ccaaagaaca agcagcagct taagaaggaa gaacaataca      3660
     aaaccactac atattgtaga aaacctgcct tattggagaa gtcactcccc ctttcctttc      3720
     tcttcataaa agcagaacaa aaagttttcc acatggctca agttatttga acctggcaaa      3780
     taataaatgt accttagaac tag                                              3803
//