spacer

EBI Dbfetch

ID   AF144095; SV 1; linear; mRNA; STD; MUS; 11769 BP.
XX
AC   AF144095;
XX
DT   04-NOV-1999 (Rel. 61, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus unconventional myosin-15 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-11769
RX   DOI; 10.1006/geno.1999.5976.
RX   PUBMED; 10552926.
RA   Liang Y., Wang A., Belyantseva I.A., Anderson D.W., Probst F.J.,
RA   Barber T.D., Miller W., Touchman J.W., Jin L., Sullivan S.L., Sellers J.R.,
RA   Camper S.A., Lloyd R.V., Kachar B., Friedman T.B., Fridell R.A.;
RT   "Characterization of the human and mouse unconventional myosin XV genes
RT   responsible for hereditary deafness DFNB3 and shaker 2";
RL   Genomics 61(3):243-258(1999).
XX
RN   [2]
RP   1-11769
RA   Fridell R.A.;
RT   ;
RL   Submitted (20-APR-1999) to the INSDC.
RL   Laboratory of Molecular Genetics, National Institute on Deafness and Other
RL   Communication Disorders, 5 Research Court, Rockville, MD 20850, USA
XX
DR   MD5; 41a2d3c2706482ab6cb18cec18976fee.
DR   Ensembl-Gn; ENSMUSG00000042678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071880; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081823; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094135; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11769
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             290..10825
FT                   /codon_start=1
FT                   /product="unconventional myosin-15"
FT                   /db_xref="GOA:Q9QZZ4"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000857"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1261811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZZ4"
FT                   /protein_id="AAF05904.1"
FT                   /translation="MADEEKKAKKGKKGKKAPEPEKPKRSLKGTSRLFMGFRDRTPKIS
FT                   KKGQFRSASAFFWGLHTGPQKTKRKKKARTVLKSTSKLMTQMRVGKKKRAMKGKKPSFM
FT                   VIRFPGRRGYGRLRPRAQSLSKASTAINWLTKKFLLKKAEESGSEQATVDAWLQRSSSR
FT                   VGSRKLPFPSGAEILRHGGRLRRFPRSHSIYSSGEPVGFLPFEDEAPFRHAGSRKSLYG
FT                   LEGFQDLGEYYDYHREGDDYYDQQSLYHYEEQEPYLAEFGGYSPAWPPYDDYGYPPGDP
FT                   YNYYHPDYYGDTLYPGYAYGYGYGYDDFEPPYAPPSGYSSPYSYHDSFESEAYPYSYYL
FT                   DPYATHHMPYPPYDFPYDTPYDIPYFDPYGVPYAEGVYGGGAEAIYPPGMPYVYPEEPA
FT                   FMYPWVPPPIMSPHNPYAHPMDDIAELEEPEETGEERQSTSFRLPSAAFFEQQGMDKPA
FT                   RSKLSLIRKFRLFPRPQVKLFGKEKLEVPLPPSLDIPLPLGDAEGEEEEEEMPPVPTMP
FT                   YTHPYWSFLTPRQRNLQRALSAFGARQGLGFGPEFGHPTPRPATSLARFLKKTLSEKKP
FT                   IPRLRGSQKARGGRPPVREAAYKRFGYKLAGMDPDRPNTPIVLRRSQPQARNNNNSHGP
FT                   PSPRPAPRALTHWSALISPPMPAPSPSPASPLTPPFSPTFSRPPRLASPYGSLRQHPPP
FT                   WAAPAHVPFPPQANWWGFAEPPGTSPEVAPDLLAFPVPRPSFRASRSRSRRAAYGFPSP
FT                   SLIGSRRRPHLPSPQPSLRSLPGQGYHSPLGPLSPQLSLRRGPFQPPFPPPPRRPQSLR
FT                   EAFSLRRASGRLGPPRSPVLGSPRPPSPPPLLKHGPRHRSLNLPSRLPRTWRRLSEPPT
FT                   RAVKPWVHRAYPPPPSAGPWGASTGALEQQENQREAEDSETPWTVPPLAPSWDVDMPPT
FT                   QRPPSPWPEGIGSLRGFSRPPPVPENPLLEHTSPSCEPQSEDRVSNLTGIFLGQHHDPG
FT                   PGQLTKSADPSLEKPEEVVTLGDPQPPAEPEALNPTPPNKNVVSERKVLRLSASYPLVT
FT                   CKQARATWPQWHRWKTVSRTPAPLAPTRAPGPLLKAGEQPRAEPGRFAVVMPQVRGVSS
FT                   FRPKGPAPVQPPEHPDQDPEQGPAPQACSLRWPCLWPPTDAHCLWSRIRTYSSQSHLRG
FT                   HGGDCHKSLWKKTRPQSWQNKMHSIRNLPSMRSREQHREDGVEDMTQLEDLQETTVLAN
FT                   LKTRFERNLIYTYIGSILVSVNPYRMFAIYGPEQVQQYSGRALGENPPHLFAIANLAFA
FT                   KMLDAKQNQCVIISGESGSGKTEATKLILRCLAAMNQRRDVMQQIKILEATPLLEAFGN
FT                   AKTVRNDNSSRFGKFVEIFLEGGVICGAITSQYLLEKSRIVFQAKNERNYHIFYELLAG
FT                   LPAQLRQAFSLQEAETYYYLNQGGNCEIAGKSDADDFRRLLAAMEVLGFTSEDQDSIFR
FT                   ILASILHLGNVYFEKHETDAQEVASVVSAREIQAVAELLQVSPEGLQKAITFKVTETIR
FT                   EKIFTPLTVESAVDARDAIAKVLYALLFGWLITRVNALVSPKQDTLSIAILDIYGFEDL
FT                   SFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQMDWREIAFADNQPCINLISLKP
FT                   YGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPLPEFTIKHYAGKVTYQVH
FT                   KFLDKNHDQVRQDVLDLFVHSRTRVVAHLFSSHAAQTAPPRLGKSSSITRLYKAHTVAA
FT                   KFQQSLLDLVEKMERCNPLFVRCLKPNHKKEPGLFEPDVMMAQLRYSGVLETVRIRKEG
FT                   FPVRLPFQVFIDRYRCLVALKLNVPADGDMCVSLLSRLCTVTPDMYRVGISKLFLKEHL
FT                   HQLLESMRERVQNRAALTLQRYLRGFFIQRHFRSLRRKIILLQSRARGFLARQRYQQMR
FT                   QSLLKFRSLVHTYVNRRRYLKLRAEQRRRAQEAWLREQEELSKREVVPVRHLEVPAEVA
FT                   GLLQAAAGLKLSSGPRVAVVRAPRLQAEPCVTLPLDINNYPMAKFIRCHFKEPSFGMLT
FT                   VPLKMPLTRLPVEHHAEAISVFKLILRFMGDPHLHGTQEMILGNYIVHQGLVEPALRDE
FT                   ILAQLANQVWRNPNAYNSKRGWLLLAACLSGFAPSPHLDKFLLKFVSDYGQNGFQAVCQ
FT                   HRLLQAMGSGAARTFPPTQLEWTAIQEKASMALDVSCFNGDQFSCPVHTWSTGEAVAGD
FT                   ILKHRGLADGWRGWTVAMKNGVQWAELAGHDYVLDLVSDLELLRDFPRQKSYFIVGAEG
FT                   PLAGRGDTRGVFGNCWDSDEDTPTRPQPQDHVAKMPDLDGYCSHKEDGTNGETEAQRWT
FT                   SNRQAVDSIGESTVPPRELDGYLDSLFDPVLACGDADLEKPTAIAYRMKGGGQPGGGGG
FT                   STSEDTSRRPPEPKLKPIPGLDASTLALQQAFIHRQAVLLAREMTLQALALQQQPLSAT
FT                   SRPQLPERPLAPEARPKTVVGTGPPAKPVLVRPTPQSWAPGSVAKAPKIPSKPVAVPIL
FT                   AQDWTAPESISASPELVRYSTLNSEHFPQPTQQIRSIIKQYKQPPWAGHPEARRTDGGK
FT                   VFRRPPDPHEEALMILKGQKTQLAVVPGTQVSREAVAMVKPVTSAPRPCMGPTPVQPSR
FT                   SLEPPEDPVQTQLHRLVNPNFYGYQDIPWRIFLRKEVFYPKDNYSHPVQLDLLFRQILH
FT                   DTFSEACLRISEDERLQMKALFAQNQLDTQRPLVTESVKRAAISMARDSWEIYFSRLFP
FT                   AMGSVGTGVQILAVSHTGIKLLQMVKGSKEASRRLRVLCAYSFADILFVTMPSQNMLEF
FT                   NLSNEKLILFSARAQQVKTLVDTFILELKKDSDYVVAVRNFLSEDPELLSFHKGDIIHL
FT                   QSLEPTRVGYSAGCVVRKKLVYLEELRRRGPDFGWRFGAVHGRVGRFPSELVQPAAAPD
FT                   FLQLPAEPGRGRAAAVVAAVASAAAAQEVGRRREGPPVRARSADSGEDSIALPPSTMLE
FT                   FAQKYFRDPRRRPRDGLKLKSKEDRESKTLEDVLCFTKVPIQESLIELSDSNLNKMAVD
FT                   MFVAVMRFMGDAPLKGQSELDVLCTLLKLCGDHEVMRDECYCQIVKQITDNSSPKQDSC
FT                   QRGWRLLYIMAAYYSCSEVFYPYLIRFLQHVSWTPGLPFQGIAKACEQNLQKTLRFGGR
FT                   LEFPSNMELRAMLAGRSSKRQLSLLPGGLERHLKIKTCTVALDVIEGLCTEMALTRPEA
FT                   FDEYVIFVVTNRGQHVCPLSCRAYILDVASEMEQVDGGYTLWFRRVLWDQPLKFENELY
FT                   VTMHYNQVLPDYLKGLFSSVPARQPTEQQLQQVSKLASLQHRAKDHFYLPSVREVQEYI
FT                   PAQLYHTTAGDTWLNLVSQHRQQTQALSPHQARAQFLGLLSAFPLFGSSFFFIQSCSNV
FT                   LVPAPCILAVNHNGLNFLSTKTHELIVKIPLKEIQSTWTQKPTANSSYPYVEISLGDVA
FT                   AQRTMQLQLEQGLELCRVVAVHVESMLSAREERLTLPPSEITLL"
XX
SQ   Sequence 11769 BP; 2666 A; 3576 C; 3180 G; 2347 T; 0 other;
     agcctgagcc tcctttccat ctctgtggag gcagacatag gacccccaac aaacagcatg        60
     caggttggga gccagccaca ggacccaggt gaaacccaag gctggtctag agaatgaatt       120
     atggatcctc gctgtccgtg ccacccagct agtcccagcg gctcagacac tgaggagaga       180
     ctgtaggttc agctacaagc aaaaagacct agctggtctc caagcagtgt ctccaagtcc       240
     ctgaacctgt gacacctgcc ccaggcatca tcaggcacag agggccacca tggcggatga       300
     ggagaagaaa gcgaagaaag ggaagaaggg gaagaaggcc ccagagcctg agaaacccaa       360
     acggagcctc aagggcacat ctcggctctt catgggcttc cgagaccgca cgcccaagat       420
     ctctaagaaa ggtcagttcc gaagtgcatc agccttcttc tggggcctcc acactggccc       480
     gcagaagacc aagcgcaaga agaaggcccg tactgttctc aaatccacat ccaaactcat       540
     gacgcagatg cgggtgggca aaaagaagcg ggcgatgaag ggaaagaagc cctcgttcat       600
     ggtgatccgc ttccctggac ggcgcggcta tggccgcttg aggcctcgtg cccagtcact       660
     tagcaaggca tccacagcta ttaactggct gaccaagaag ttcctcctca agaaggccga       720
     agagtcaggc agtgagcagg ccacagtgga cgcctggctc cagcgctcca gctcccgagt       780
     tggctcacgt aagctgccct tcccgtcggg tgctgagatc ctgcggcatg gaggccggct       840
     ccgcaggttc ccccgcagtc atagcatcta ctcctccgga gagcccgtgg gcttcctgcc       900
     ctttgaggac gaagccccat ttcggcacgc aggctcccgc aagtcattgt atgggctcga       960
     gggcttccag gacctgggtg aatattacga ctaccatcgg gaaggcgacg actactatga      1020
     ccagcagtcg ctataccact acgaggagca ggagccctac ttggctgagt tcggtgggta      1080
     tagcccggcc tggccaccct atgatgacta tgggtaccca cccggagacc cgtacaacta      1140
     ctaccaccct gactactacg gtgacaccct ctaccctggc tatgcctatg gctatggcta      1200
     cggctacgat gattttgagc ccccatatgc gcccccatca gggtattcat cgccttacag      1260
     ctaccatgac agctttgaga gtgaggccta cccatacagc tactacctgg acccctatgc      1320
     aactcaccac atgccctatc caccctatga ctttccatat gacactcctt acgacatacc      1380
     ctactttgat ccttatgggg ttccctatgc tgaaggtgtc tatggcggtg gggccgaggc      1440
     catctatccc cctgggatgc cctatgtcta tccagaagag ccagctttta tgtacccatg      1500
     ggtgccgcca cccataatgt cgccccacaa cccatatgcc caccccatgg acgacattgc      1560
     cgagctggag gagcctgagg aaacaggtga agaacgtcag agcacctcct tccgcctgcc      1620
     cagtgccgcc ttcttcgagc aacaaggtat ggacaaacca gccaggtcca aactatccct      1680
     catccggaag ttccgcctct tcccacggcc tcaggtgaag ctgtttggga aagagaagct      1740
     agaggtgccc ctgccaccct ccctcgacat tcctctgcct ttaggggatg cagagggtga      1800
     ggaagaggag gaggaaatgc ccccagtgcc cacgatgccc tacacccacc cttactggag      1860
     cttcctcaca ccgcgccagc gaaacctaca gcgcgccctg tcagcctttg gtgcccgcca      1920
     aggcctaggc tttggccctg agtttggcca cccaacgcca cgcccagcca cctcactggc      1980
     acggttcctc aaaaaaacac tgtcagaaaa gaagcccatt ccacggctca ggggcagcca      2040
     gaaggcccga ggagggcggc ccccagtgag ggaggcagcc tacaaacgct ttggctacaa      2100
     gctggccggc atggaccccg atcgacccaa cacgcccatt gtgctgagac gaagtcagcc      2160
     acaagctcgc aacaacaaca actcccacgg gccaccgtca cccaggcctg caccaagggc      2220
     actcacgcac tggagtgctc tcatctctcc tccaatgcct gcgccatctc ccagccccgc      2280
     ctctccattg accccaccct tctctccaac cttctcccgg cctccaaggc tagcttcccc      2340
     ctatggctcc ctccgccagc atccaccacc ctgggctgcc ccagctcatg tgccttttcc      2400
     accccaggca aattggtggg gctttgctga accccctgga acaagcccag aggttgcgcc      2460
     tgaccttctg gcctttcctg taccccggcc ctcgttcagg gcttcccgca gtcgcagtcg      2520
     gagggcagct tatggtttcc ccagcccttc cctgatagga tccaggagaa ggccccacct      2580
     gccctcaccc cagccctctc tgaggagcct tccaggtcag ggctaccact caccactggg      2640
     accgttgtct cctcagttgt ccctccgaag gggtcctttc cagccaccct tcccaccccc      2700
     tccacgcaga cctcagtcac tccgggaggc cttctctcta cgtagagcct ctgggcgcct      2760
     gggcccaccc cgctcaccag tgctaggttc tccccgacca ccctcaccac ccccactcct      2820
     gaaacacggc ccccggcacc ggtccctcaa cctgccctca cgccttccac ggacctggcg      2880
     gcgcctcagc gagcctccta cgcgggctgt gaaaccatgg gtacataggg cgtacccccc      2940
     accacccagt gccgggccct ggggggcatc cacgggggct ttggagcagc aagagaacca      3000
     acgtgaagca gaagactcag aaacaccgtg gacagttccc ccattggccc ccagctggga      3060
     tgtggatatg cctcccacac aacgcccacc ttctccgtgg ccagaaggta taggcagcct      3120
     tagaggcttc tccaggcccc ctcctgtgcc tgaaaatcca ttgcttgagc acacaagccc      3180
     ttcatgtgag ccacagtctg aggaccgagt ctctaattta actggtatct tcctgggcca      3240
     acaccatgac ccagggcctg ggcaactcac caagtcagcc gacccaagct tggagaagcc      3300
     tgaagaagtg gtcaccctag gggaccctca gccaccagct gagcctgagg ccctgaaccc      3360
     aacacctccc aacaaaaatg ttgtctcgga gaggaaggtt ttacgactca gcgcctcgta      3420
     cccactggtc acatgtaagc aggcaagggc aacatggcca caatggcacc gctggaagac      3480
     agtgtctaga actccagctc ccttggcccc caccagagcc ccagggccct tgctcaaggc      3540
     tggtgagcag ccccgggcag aacctgggcg gtttgcagtt gtcatgcctc aggtgcgtgg      3600
     ggtaagctcc ttccggccaa aagggcctgc tcctgtgcag cctccagagc atccagacca      3660
     agacccagag cagggcccag ccccccaagc ctgtagtcta cgctggccct gcctctggcc      3720
     accaacagat gctcactgtc tctggtcacg aattcgcacc tactcctctc aatcccacct      3780
     ccggggccat ggaggtgact gtcacaagag cctctggaaa aagactcgcc cccaaagctg      3840
     gcagaacaag atgcactcca tacgcaacct gccttctatg cggtcccgtg agcagcacag      3900
     ggaagatgga gtggaggaca tgacgcagct ggaagacctc caagagacca ctgtgctagc      3960
     caacctaaag accagatttg agcgaaacct catctatacc tatattggca gtattctggt      4020
     gtcggtgaac ccatatcgaa tgtttgcaat ctacgggcct gagcaggtgc agcagtacag      4080
     tgggcgtgcc ctaggagaaa atcccccgca cctctttgca attgctaatc ttgccttcgc      4140
     caaaatgctt gatgccaaac agaaccagtg tgtcatcatc agtggggaga gtggctctgg      4200
     aaagactgag gctacgaaac tgattctgcg ctgcctggct gccatgaacc agagacggga      4260
     cgtcatgcag cagataaaga tcctggaggc aacgcctctc ctggaggcct ttggtaatgc      4320
     caaaactgtc aggaatgaca actccagccg ctttgggaag tttgtggaaa tctttctaga      4380
     agggggtgtg atctgtggtg ccataacctc tcagtacctg ctggagaagt caaggattgt      4440
     gttccaggcc aaaaatgaaa gaaattatca tattttctat gagctgctgg ctgggctccc      4500
     tgctcaacta agacaggcct tcagcctgca ggaggctgag acctactact acctgaacca      4560
     gggcgggaac tgtgagatcg ctggaaagag tgacgcagat gacttccgcc gtctgctggc      4620
     tgcgatggag gtgcttggct tcaccagtga ggaccaggac agcatcttcc gaatcctagc      4680
     ctccatctta cacctgggca atgtctattt tgagaaacat gagaccgatg cccaggaggt      4740
     ggcctcggtg gtgagcgccc gggagatcca ggctgtggca gagctgcttc aggtctctcc      4800
     tgagggcctg cagaaggcta tcaccttcaa agtgactgag acaattcgag agaagatctt      4860
     cacaccccta acagtggaga gtgccgtaga tgccagggac gccatcgcca aggtcttgta      4920
     tgcactgctg tttggctggc tcatcaccag ggtcaacgct ctggtgtccc caaaacaaga      4980
     tacattgtcc atcgccatct tggacatata tggctttgag gacctgagct tcaacagctt      5040
     tgaacaactg tgcatcaact atgccaacga gaaccttcag tacctgttca acaagatcgt      5100
     cttccaggag gagcaggagg agtacatccg ggagcagatg gactggagag agattgcctt      5160
     tgctgacaac cagccctgca tcaacctcat ctccctgaag ccctacggca tcctgcgcat      5220
     cctggatgac cagtgctgct ttccccaggc cacagaccac acattcctgc agaagtgcca      5280
     ctaccaccat ggcgccaacc cgctctactc taagcctaag atgccactgc cagagtttac      5340
     catcaagcac tatgcaggca aggtcaccta ccaggtgcac aagttcctgg acaagaacca      5400
     tgaccaagtg cgccaagacg tcctggactt gtttgtgcac agccgcacaa gggtggtagc      5460
     acaccttttc tccagccacg ctgcgcagac tgcccctcca cgcctgggca agagcagctc      5520
     cattacccgt ctctacaagg ctcacacggt ggcggccaag ttccagcagt ccctcctgga      5580
     cctggtggaa aagatggaga ggtgtaaccc tttgttcgtg cgctgcctga agcccaacca      5640
     taagaaggaa cctggtctct ttgagccaga tgtgatgatg gcacagttac gctattcagg      5700
     ggttctggag actgtgagga tccgcaagga aggctttccg gtgcggctac ccttccaggt      5760
     gtttatcgac aggtaccggt gcctggtggc cctcaagctc aacgtgccag cagatgggga      5820
     catgtgtgtg tcattgctga gccggctatg cacggtcact ccagacatgt accgtgttgg      5880
     gattagcaag ctcttcctca aggagcacct gcaccagcta ctggagagca tgcgggagcg      5940
     agtccagaac cgagctgccc tcaccctgca gcgctacctg cgaggttttt tcatccaacg      6000
     gcacttccgg tccttgcggc ggaagatcat cctactgcag agcagagccc gtggttttct      6060
     ggccagacaa cgctaccagc agatgaggca gagtctgctg aagttccgtt ccctggtgca      6120
     cacctacgtg aaccgccgcc gctacctcaa gctgagggca gagcagaggc gccgggcaca      6180
     ggaggcatgg ctacgtgagc aggaggagct gagcaagcgt gaagtggtcc cagtgagaca      6240
     tctggaggtg ccagctgagg tggctgggct cctgcaagcc gcagcaggcc tcaagctgtc      6300
     cagtgggccc cgagtggctg ttgtccgggc tcctaggctc caggctgagc cgtgtgtcac      6360
     acttcccctt gacatcaaca actaccccat ggccaagttc attcgatgcc acttcaagga      6420
     accctccttt gggatgctga cagtgcccct gaagatgcct ctcacacggc tgcctgtgga      6480
     gcaccacgca gaagccataa gtgtctttaa gctaatcctg cgtttcatgg gagaccccca      6540
     cctgcatggc acccaagaga tgatcttggg gaactacatt gtgcaccagg ggctggtgga      6600
     gccagctctg agggacgaga tcctagccca gctggccaac caggtgtggc gcaatcccaa      6660
     tgcctacaac tccaagcggg gctggttgct gttggctgcc tgtctcagtg gctttgcgcc      6720
     ttccccgcac cttgacaagt tcctcctcaa gtttgtatct gattatggac agaatggctt      6780
     ccaggctgtg tgccagcatc gcctcctgca ggcgatgggc tcaggggctg cccggacctt      6840
     tcccccaact cagctggagt ggactgccat tcaggagaag gccagtatgg ctctagatgt      6900
     gagctgcttc aatggtgacc agttctcctg tccggtccac acctggagta cgggggaagc      6960
     ggtggctgga gacatcctaa agcacagggg gctggctgat ggttggaggg gctggacagt      7020
     ggccatgaag aatggagtcc agtgggcaga gctggctgga catgactatg tgctggacct      7080
     ggtatcagac ctggaactgc tcagggactt cccacgacag aaatcttact tcatagtggg      7140
     tgcagaaggg cctttggctg gcaggggaga caccagagga gtgtttggga actgctggga      7200
     ctcagacgag gacacaccca caaggcccca gccccaggac cacgtggcca agatgcctga      7260
     cttggatggg tactgcagcc acaaagagga tggtacaaat ggagaaactg aggcccagag      7320
     atggacatcg aaccgccaag ctgtggacag cattggagag tccactgtgc cccccaggga      7380
     gctggatggc tacttggaca gtctcttcga ccctgtgctg gcctgtgggg atgcggacct      7440
     ggagaagccg acagccatcg cctaccgcat gaaaggtggg ggccagccag gtggaggtgg      7500
     tggcagtact tctgaagata cctcccggag acccccggaa cccaagctca agcccatccc      7560
     aggcctggat gcctccacac tggctctgca gcaagccttc atccacaggc aggctgtgct      7620
     actggcccgg gagatgaccc tgcaggcttt ggcacttcag cagcagcctc tgagtgcaac      7680
     ctcaagacct cagctcccag agagacccct agcaccagag gcacggccga agactgtagt      7740
     aggcactggc cccccagcca agcctgtgct ggtgcgtccg actccacagt cgtgggctcc      7800
     gggctctgtg gcaaaggccc cgaagatacc tagcaagccc gtggctgtcc caatcctagc      7860
     tcaagattgg actgctccag aatccatttc ggcttcccct gagctggttc ggtattccac      7920
     actcaactca gagcacttcc cacaacccac acagcagatc agaagcatca tcaagcaata      7980
     caaacagcca ccctgggcag gacaccctga ggcccgcagg acggatggtg gaaaggtctt      8040
     caggaggcca cctgaccccc atgaggaggc cctaatgatt ctgaagggac agaagactca      8100
     actagcagta gtgcctggca ctcaggtgtc cagagaggct gtggccatgg tgaagccggt      8160
     gaccagtgct ccaaggccat gcatggggcc cactccagtg cagccttcaa ggtcgctgga      8220
     gcctccagag gatcctgtgc agacacagct gcaccgccta gtcaacccca acttctatgg      8280
     ctaccaggac atcccctggc ggatcttcct gcgcaaggag gtattttacc ccaaggacaa      8340
     ctacagtcac cctgtgcagc tagacctcct gttccggcag atcctgcatg acacattctc      8400
     cgaggcttgc ctgcgcatat ctgaggatga gcggctgcag atgaaggctc tgtttgccca      8460
     gaaccagctg gacacacagc gacctctggt aacagaaagt gtgaagcggg ccgccatcag      8520
     catggcccga gacagctggg agatctactt ctctcgcctc ttcccggcaa tgggcagtgt      8580
     tggcaccggc gtgcagatcc tagctgtgtc tcacactggc atcaagctcc tgcagatggt      8640
     caagggcagc aaggaggcca gcaggcggct ccgcgtcctg tgtgcataca gctttgcaga      8700
     catcctgttt gtaaccatgc catctcagaa catgctagag ttcaatctgt ccaacgagaa      8760
     gctcatcctc ttctcagccc gggcgcagca ggtcaagacc ctagtagaca ccttcattct      8820
     ggaactgaag aaggattctg attatgttgt ggcagtgagg aacttcctgt ctgaagaccc      8880
     cgagctgctg tccttccaca agggtgacat catccacctg cagagcctgg aaccaactag      8940
     agtgggctac agcgccggtt gtgtagtccg caagaaactg gtgtacctgg aggagctgag      9000
     gcggagaggc cctgactttg gctggaggtt cggggccgtc cacgggcgcg taggacgttt      9060
     tccttcagag ctcgtgcagc ccgcagctgc tccagacttc ttgcagctcc cggcagagcc      9120
     agggcggggc cgggctgccg cggtggtcgc cgctgtggcc tctgcagcag ccgcacagga      9180
     ggtggggcgc cggagagagg gtcccccagt cagggcgcgt tccgctgaca gcggagagga      9240
     ttccatagcg ctcccaccga gcacaatgct cgaatttgcc cagaagtatt tccgagaccc      9300
     tcggaggcgt ccccgggatg gcctcaagct gaagtctaag gaggatcggg agtccaaaac      9360
     tctggaggac gtgctttgct tcactaaggt cccgatccag gaatccctca ttgaactcag      9420
     tgacagcaat ctcaacaaga tggcggttga catgtttgta gctgtgatga ggttcatggg      9480
     agatgcccca ctgaagggcc agagcgaact ggatgttctc tgcacccttc tgaagctttg      9540
     tggagaccat gaggtcatga gagatgaatg ctactgccag attgtgaagc agatcacaga      9600
     caacagcagc cctaagcagg acagctgtca gcgaggctgg aggctgcttt acatcatggc      9660
     tgcctactat agttgctctg aggtcttcta tccatacctc attcgcttcc tccaacatgt      9720
     gagctggact cctggcctgc ccttccaagg gattgccaag gcctgtgaac agaacctgca      9780
     gaagaccttg cgttttggag gccgcctgga gttccccagc aatatggagc tccgtgctat      9840
     gttggcaggc cgcagttcca agaggcagct ctctcttctt ccaggaggcc ttgaacgcca      9900
     tctgaaaatc aaaacgtgca cggtggccct ggatgtcata gaggggctct gtaccgagat      9960
     ggccctgaca cgccctgaag cctttgatga gtatgtcatt tttgtggtca ccaaccgagg     10020
     ccagcacgtg tgtccactga gctgccgggc ctacatactg gatgtggcct cagagatgga     10080
     gcaggtggac gggggctaca cactctggtt ccggcgggtg ctttgggatc agccactgaa     10140
     gtttgagaat gagctgtatg tgaccatgca ctacaatcag gttctgcctg actacctgaa     10200
     gggcctcttt agcagtgtgc cggccaggca gcccacagag caacaactac agcaggtgtc     10260
     caagttggct tcactgcagc accgagccaa ggaccacttc tacctgccca gtgtgcgtga     10320
     agtccaagag tacatcccag cccagctcta ccacaccacg gccggtgaca cctggctcaa     10380
     cctggttagc caacacaggc agcagactca ggcgctcagt ccccaccagg cccgcgctca     10440
     gttcctgggc ctcctcagtg ccttcccctt gtttggctcc tccttcttct tcatccagag     10500
     ctgcagcaat gtcttggtgc cagccccctg tatcctcgct gtcaaccata acggcctcaa     10560
     cttcctcagc accaagaccc atgagttgat tgtgaagatt cccctgaagg agatccagtc     10620
     cacgtggact cagaagccca cggccaattc cagttacccg tatgtggaga tctccctggg     10680
     ggatgtggca gcccagcgga ccatgcagct ccagctggag cagggtctgg agctgtgtcg     10740
     cgtggtggct gtgcatgtgg agtccatgct cagcgcccgg gaggagcggc tcacactgcc     10800
     tcccagcgag atcaccctct tgtgacgtgg cctacctttt cactgcttcc cgccagaaga     10860
     tttgctccat gccctgaggg tagatgctca gcctctccag accaagtgac tcttggggtg     10920
     ctggggagat gactcaacag ttaagaacat tggctggtga aaaaaagaac attggctgtt     10980
     tttccaggga cctgggttca attcctagta tccacataac agctcacaac catttgtaac     11040
     tccagttcta tgatgttgtc catgggtacc aggtacacat gtgatgcaga catatgtgca     11100
     ggcaaaatac ctagacaaga gccagaacct tggaggagac caaaggagac aggaggaaaa     11160
     actcaagaac ccaagaggac caatctggag ctgggatgga gttacgggtg cagccaaggc     11220
     ttacttagca gaagtggttt ttaaaagctg gaccacaggg cctccagaag gcagagcctg     11280
     ccttgacaac tgcccttgac agggaagccc cacactagta gtttagatgt tttgggggct     11340
     gcctctggtt tcttggggct tgatactcag atctgctccg gcgtcacact ccagccttcc     11400
     gcatgtcctt gccaggtgcc ctcagctcag acctaggacc cttagtcatt tcttcacaag     11460
     tatttctggt ctgtcctccg tgctgacaga ttgagtcaga atgactttaa attcaaaatc     11520
     aactcaggct acagagcaag accctgcctg aggggagggg tgctggggag atgactcaac     11580
     agttaagaac attggctggt gaaaaaaaga acattggctg tttttccagg gacctgggtt     11640
     caattcctag catccacata acagctcaca accatttgta actccagttc tatgatgttg     11700
     tccatgggta ccaggtacac atgtgatgca gacatatgtg caggcaaaat acccatatcc     11760
     ataaataaa                                                             11769
//


spacer
spacer