Dbfetch

ID   AF142674; SV 1; linear; mRNA; STD; MUS; 1784 BP.
XX
AC   AF142674;
XX
DT   02-JAN-2000 (Rel. 62, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus beta-1,4-galactosyltransferase VI mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1784
RA   Lo N.-W., Shaper N.L., Shaper J.H.;
RT   "Murine beta-1,4-galactosyltransferase family members";
RL   Unpublished.
XX
RN   [2]
RP   1-1784
RA   Lo N.-W., Shaper N.L., Shaper J.H.;
RT   ;
RL   Submitted (14-APR-1999) to the INSDC.
RL   Oncology, Johns Hopkins, 600 N. Wolfe St., Baltimore, MD 21287, USA
XX
DR   MD5; 404afa8b25ca322fb584b6e017461854.
DR   Ensembl-Gn; ENSMUSG00000056124; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070080; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1784
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             146..1294
FT                   /codon_start=1
FT                   /product="beta-1,4-galactosyltransferase VI"
FT                   /note="beta4GalT-VI"
FT                   /db_xref="GOA:Q9WVK5"
FT                   /db_xref="InterPro:IPR003859"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR027995"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1928380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WVK5"
FT                   /protein_id="AAF22224.1"
FT                   /translation="MSALKRMMRVSNRSLIAFIFFFSLSTSCLYFIYVAPGIANTYLFM
FT                   VQARGIMLRENVKTIGHMIRLYTNKNTTLNGTDYPEGNNTSDYLVQTTTYLPQNFTYLP
FT                   HLPCPEKLPYMRGFLSVNVSEISFDEVHQLFSKDSEIGPGGHWRPKDCKPRWKVAVLIP
FT                   FRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDRAWD
FT                   CVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKIN
FT                   GFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRY
FT                   SKERQYIDGLNNLLYTPKILVDRLYTNISVNLMPELAPIEDY"
XX
SQ   Sequence 1784 BP; 483 A; 420 C; 413 G; 468 T; 0 other;
     ctcggttctt ctccccacag cctccccggc cggaccccgc caccttcttg gggtcctccg        60
     tacattcatg gaagtttagg gcctggaccg tggcccggag tctggcctga gagcgcagcc       120
     cgcgctactg gcagggcaga ggaagatgtc tgcgctcaag cggatgatgc gggtctccaa       180
     tcgctctctg attgccttca tcttcttctt ctccctctcc acgtcctgtc tctacttcat       240
     ctatgtggct ccaggcatcg ccaacacgta cctctttatg gtacaagcta gaggtatcat       300
     gctgagagag aatgtgaaaa caattggaca catgatcagg ctgtatacca ataaaaacac       360
     tacgctcaac ggaacagatt atcctgaagg caataataca agtgactatc ttgttcaaac       420
     aacaacgtat cttccgcaaa acttcacgta tttgccacac ctcccctgtc cagagaagct       480
     gccttacatg cggggattcc tcagtgtcaa tgtgagtgag atcagttttg atgaagtcca       540
     tcagctcttc tccaaggact cagagattgg gccaggaggc cactggaggc ccaaggactg       600
     caagcccaga tggaaggtgg cagttctcat ccccttccgt aaccgccatg aacatcttcc       660
     gatttttttc ctgcacctga ttccgatgct ccagaaacag cggctggaat ttgcctttta       720
     tgtcatcgaa cagaccggca cacaaccatt caatcgtgcg atgctcttta atgtgggttt       780
     caaagaggcc atgaaagaca gagcctggga ctgtgtgatc ttccatgatg tggatcatct       840
     gcctgaaaat gatcggaact attacggatg tggagagatg ccgcggcact ttgcagcgaa       900
     gctggacaag tacatgtaca ttcttcccta taaggagttt tttggtgggg tgagtggcct       960
     gacggtggag caattcagga agatcaacgg ctttcccaat gccttctggg gatggggagg      1020
     cgaggacgat gacctttgga acagagttca ctacgccggc tacaatgtaa cccggccaga      1080
     aggggacttg ggaaaataca tatctattcc tcatcaccat cgaggggagg tacagttcct      1140
     aggacggtat aaattacttc ggtattccaa ggagcggcag tacatcgatg gactgaacaa      1200
     tttattatac acacccaaaa tactggttga taggctgtat acaaatatat ctgtaaacct      1260
     catgccagaa ttagctccaa ttgaagacta ttaaaagaag tcattctcat ggtggggtag      1320
     accacagtgc tggatcatga acttggcttg gagtgccctc accgtggaag ttagagattg      1380
     gggtgtatct cagtgtcccg gtctgtaaaa agagccagca atccttaatg tttacagcgc      1440
     gggctccatc cgtcacactc tcccactctc cccctgctgg gagcgtctcc ccatggcaag      1500
     cactgtagag ataagaaccc attgcttggg actggaagtg aagaaaactc cctacacaga      1560
     gaagattttt atactgaaat ctataattta attcaagaga atgcttttat ttccgttcaa      1620
     acatattttg tacatatgtg atgtaaatta aatgtgttca aattgttgga aaacaagatg      1680
     tcacaatttt gcatgtaatt ggttatgcct tcattggact tttatagaca tttttttatt      1740
     tgcatgggga aatttttaaa tataaaaaaa aaaaaacaaa aaaa                       1784
//