spacer

EBI Dbfetch

ID   AF142647; SV 1; linear; genomic DNA; STD; MUS; 7005 BP.
XX
AC   AF142647;
XX
DT   14-DEC-1999 (Rel. 62, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mus musculus forkhead transcription factor FOXE3 (FoxE3) gene, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-7005
RX   PUBMED; 10652278.
RA   Blixt A., Mahlapuu M., Aitola M., Pelto-Huikko M., Enerback S.,
RA   Carlsson P.;
RT   "A forkhead gene, FoxE3, is essential for lens epithelial proliferation and
RT   closure of the lens vesicle";
RL   Genes Dev. 14(2):245-254(2000).
XX
RN   [2]
RP   1-7005
RA   Carlsson P.;
RT   ;
RL   Submitted (13-APR-1999) to the INSDC.
RL   Molecular Biology, Goteborg University, P.O. Box 462, Goteborg S-405 30,
RL   Sweden
XX
DR   MD5; 0bfeffe2da709b36a72755d62b68a339.
DR   Ensembl-Gn; ENSMUSG00000044518; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050940; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7005
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /map="4C7"
FT                   /strain="129/Sv"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="lens"
FT                   /db_xref="taxon:10090"
FT   CDS             3846..4712
FT                   /codon_start=1
FT                   /gene="FoxE3"
FT                   /product="forkhead transcription factor FOXE3"
FT                   /note="similar to Homo sapiens FOXE3/FREAC8/FKHL12"
FT                   /db_xref="GOA:Q9QY14"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="MGI:MGI:1353569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QY14"
FT                   /protein_id="AAF15997.1"
FT                   /translation="MDAQVAFSGFPALPSLTPSGPQLPTLAGAEPGREPEEVVGGGDAE
FT                   PTAVPGPGKRRRRPLQRGKPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDS
FT                   PRKWQNSIRHNLTLNDCFVKVPREPGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRA
FT                   ELPAPPPPPPPFPYAPFPPPPAPASAPPARLFRLDSLLGLQPEPPGPVAPEPPCCAAPD
FT                   AAFPPCAAAASPPLYSPASERLGLPAPLPAQPLLALAGSAGALGPLGAGEAYLRQPGFA
FT                   PGLERYL"
FT   misc_feature    4020..4337
FT                   /gene="FoxE3"
FT                   /note="Region: forkhead box"
XX
SQ   Sequence 7005 BP; 1571 A; 1884 C; 1878 G; 1672 T; 0 other;
     agatctttgg gggtgagggg tctggggaca tctcaggctg gcctcttgag acctctttgg        60
     gttaatatag ctatttccag agcactgtat gagcaatgat ggcgtgagaa tcttatccaa       120
     ggacctgaaa tgacttccag ttacagcacc tcctccccac aacccctgga gagtacttgg       180
     taagttctaa ctgcacttct ggtccctgcc tccaagtctg tctgagctaa tggtgcttct       240
     caagccagca ctgaggcaga gggtcttaga gcctagcgca aatagctttg gaacaggtgg       300
     atttccactc ctatctggag atccatcaac gttgtgtgcc ctgacctggc cttggcctcc       360
     aaagggcaat ggaaggccgg ccccagggcc aatccctggc cattaatccc tcctgccagc       420
     ccgaatatcc acccagtgtg gtcagacaaa ggactgccca gcccagctac tgtgttcctc       480
     ccgccccagg ggctccactc agacgatggg ccgcctggaa tccaggccca tgagaaaggg       540
     gccaccttca ctggccgtct tatgcccgga tgctcagccg catcacgtcc ggcccagggc       600
     ctgtgaaaag agggcccagc cacgctgaaa acgcggatta gcccttgggc cgccccctga       660
     caccagcttg ctccactctg ggaagcaggc ccaatggagg gcgggggcgg gggggaaggt       720
     aggcaggcac aaagaactgg gttctcaccc ctttggctca gctcctcatc cccacccttc       780
     tcagaattag catagccaga cacacattca ggatcattta ttgaacatat attacgtccc       840
     agactatgca catggcctgg gaagttgaag gtacaaacaa aaaccaacca aacaaccaaa       900
     caaccaacca aacaaaaaac ccctgtagtc agccatagag tgcaattaca actaatttct       960
     tccttggagg tattacacag aagcctatga gcctatgaaa ggagtttcat tccctagagg      1020
     aaagcgagaa aaggctaagg ctctatcaat actagtttct gcatttgagt tccacctgca      1080
     ggaataacac tgtctggaaa gatagccaga atggctctct ttgccccctg attaacacag      1140
     tgggggtggg ggggtggggg tgggggtggg gggagcttct tatcaagatc cacagcaggc      1200
     cgggccttct atacatccct tactatggag atgccattgc tttcacttgg caggcttgag      1260
     caagaggtga ccttgctcat gtggctctgg gggccatgct ctgccgccac agtggcttgc      1320
     cttgtcctct tctgtggtga gcagtgtgat gtgacttcac tgtcttgtgc tccaggtggg      1380
     ctgtgctgac acaggatgaa ctgaggagcg ggtagaggag cagggtctgt tctaacacag      1440
     tcgtccttgt tttgtttggg acattgtctc ttgacctgca agtgtcatca tcttcctgtc      1500
     tgcttcccca ttctcctcca ccccccttcc ctgtgtgtaa ctgtccattt ctcctctgga      1560
     ccatttcatt tctatctggt cctgagcatt ggcaaaaggc ctggctcgga agctcttggt      1620
     gaatgaggca gctgaactga gtccagaaac tgaaggagaa atggatttgg gatctgtgtg      1680
     gccttgaaca ggatgtggca gtggcctggt atagggactc attcaaagaa gggatggtac      1740
     ttactgagac tgggaaggtt ggtaaccgag caggctgagg ctggggaggg agctttgaga      1800
     cgttgtgagg tgatgcccaa tgggcatctc catcagttga ccgggaggtc aggagagaga      1860
     ccgggaagta actttggcag ctgaagtggg gcaaactgga ggaattctac tgtaattcat      1920
     ttatgaagtc ttatctctcc tttgtgtgca tgttatacaa atggtgtgta ggggtatgca      1980
     tgcatttgga agtgcccatg tgtggaggtc agaggacaat cttgagtgtc agtcctcacc      2040
     tttgagacag ggtctcttgt tcacagctgc ctacagtagg acaactcccc acaagtttct      2100
     ggggattccc ttgtctctgc ctcctgtctt gtcacccggg taccgggact actgatacac      2160
     tgctgagtcc aatttcatgt tggttctgaa gttctgactt cacacttgca tgtcaagaac      2220
     ttaactcatt aaaaaaaaaa agaacttgac tcatcaagcc atcttcccca tttatcaagc      2280
     catcaagccc cttttattta tttttgatat ggagtaccac tacatagcct agcctagcct      2340
     aacctagcct agcctagcct ataagtggcc tcagtctctc cagtgcaggg accacacatg      2400
     catgccacta tgctggacta aagcttccat tgtaaggaaa ggcattagaa gagcagtgat      2460
     gggtagtgct ctgaccacag ggtttcattt ctgctctgcc actattagtg taccttgtgg      2520
     gagtcgaggt atactacttt acctctcaga gcacctgttc cctcagccaa gaaacgggga      2580
     tagtactacc gcccagtgga gcttaaatgc cagtgaaata ctataagtat ttaccaaata      2640
     caaaatgcta aacagtggta gctgtgattt gttatcagct gtgtacagga ggggagtctt      2700
     tgagccccat gcttgaattt ggattttgca tccttggcta caggccacct gaatctagcc      2760
     tttgggcatc tgcactaaac taccaaatta gagggcaggt ccgagccctc tcctctcgag      2820
     gtaagggata agatatgctt catcagagat ggagtctgat gggtgcccaa attttctcaa      2880
     gggctggctg tactcacaag accttggcag taagtgcctc tgggacttgt cacagtaaga      2940
     ccttctcttg tctctgtgct ccttgctctg cctctacttc ccttgaatct tgtcagtctg      3000
     cctgctttaa gaacaaggct tctccgcctt tggctctctc tgtgtgctgg tggggcattt      3060
     taacaaaaac tctcccctct ctctacccac tgataatgct acatcagaaa gcagttcgct      3120
     cagccctgcc ttcagtggaa gcatgtgggg gggggtatgc gccttttggg ggggagaggt      3180
     ggagttatgt atgtttgaaa caagtttccc tggagtcagg gatggataag gatgaagggg      3240
     gtgcagcagg gaaaggagtt agggcttcta aacattttcc cctgcaacaa aggcagcctg      3300
     gttctgcgct gtcttgctgt cttccatcat cttcactctg gttctctgct gtccaaagga      3360
     gcctgatgcc tccctgacca gctacatagg atgcctgagg ctagcaaaga ctgctggagc      3420
     gggaactaga agcatgggga aggctaaggg ggatctgacc tctacaaggc acaaaatggg      3480
     gagagggcag tagagtgtgc tgaatgggtg tgtttgtaat tggggttgac ccaaaggggc      3540
     gggggtaatg ggagcagtac taccaaatac cacgggatgg ggatggggcc cagagactga      3600
     ctcagggatg agggagggtc tgaaaaaaat tgacccagag ggactagacc aagggagggg      3660
     gagaaacaga ggtgggctgc cagcccggga agggggctgg gaaagcaaat tagagggcag      3720
     gtcagggccc tctcctcggg aggtgggagt gtgtgtgtcc atataaggcg aacctgcgac      3780
     ccccgctctc cggggcgcga gcagggactc cgcatcccta ggacccccac ccccaccccc      3840
     cgcacatgga tgcgcaagtc gctttctcgg gcttcccggc cttgccctcg ctcacgccgt      3900
     ccgggccgca gctgccgacg ctggcgggag ccgaaccggg gcgcgaaccg gaggaagtgg      3960
     tgggcggtgg ggacgccgag cccacggccg tgcctggccc ggggaagcga cggcggcggc      4020
     cactacagcg tgggaagccg ccctactcat acatcgcgct cattgccatg gccctggcgc      4080
     acgctccggg ccgccgtcta acgctggcag ccatctaccg cttcatcacc gagcgcttcg      4140
     ccttctaccg cgacagcccg cgcaagtggc agaacagcat ccgccacaac ctcaccctca      4200
     acgactgttt cgtcaaggtg ccgcgcgagc cgggcaatcc gggcaagggc aactactgga      4260
     cgctcgatcc cgcggccgct gacatgttcg acaacggtag cttcctgcgg cgccgcaagc      4320
     gcttcaagcg cgctgagctg cccgcaccgc cgccgccgcc gccgcccttc ccctatgcgc      4380
     ccttcccgcc cccgccagca cccgcgtccg ctccgcccgc gcgcctcttc cgcctggaca      4440
     gcctgttggg cttgcagcct gagccgccgg gacccgtggc gcccgagccg ccttgctgcg      4500
     ccgcgcccga cgccgccttc ccgccctgtg ccgccgcagc ctcgccgccg ctctactcgc      4560
     cagcgtccga gcgcctgggg ttacccgcgc cgctgcccgc ccagcctctc ctggccttgg      4620
     cgggatcggc cggcgcgctc gggccgctcg gagccgggga agcctacctg agacagccgg      4680
     gcttcgcgcc ggggctggag cgctacctgt gagtcgcttt ccgctgcggg agcgcctggt      4740
     ggagccttct gccccggcct gcgctggagc agtgcgagct tgtccgtggt acccgtaccc      4800
     gcccgcccgc agcgtggcgc aattcgctgg gtccccgagc cttgcttggg gctaagcctt      4860
     ccctgccctc ctccatccct ggggagaccc tggctgtctc accaccagac tgaagcgccc      4920
     tctccaattt gaggtctttc ctccctttac ttgtgctccc cacataagca cccttgcact      4980
     gccaaatccg gtgctttgga actccagccc cagccccaaa tgtccctgtg agttccagtc      5040
     tgtggaaact tttcgttcca aggcacctcc tccatctctg atgttttgcc aacacatcag      5100
     aggtcagact cctgggttca ttacttctac cccatcttcc tccatttacc gataagtttg      5160
     gcaaatttgt tccctgccct aggtttacag tctgtgcttg ttttcttacc gagcctgtct      5220
     ccgacaaaga ctcacctgag ggctctgctc tgaacagttc ttcagatttt ctaggttact      5280
     cggcaccagg atctcctgac tgaatgggga attaatggga gtctgtggct gctccacccc      5340
     atggaaagca cagaacttat ctgtttatgg ttatttttca atcaaagctg gtttaattaa      5400
     aacaaaaaca aagaaacatt tttctgggtt tgttgtgttg gctgggaact tgggagttgc      5460
     tgggaaagat ggtgggtgac atttgcctca ttgggattcc atgtgggatg actctccttc      5520
     taagtcatta ggcagattct cctgaagtag caccaaggag tgattccaca cagtaggcct      5580
     ggtcaaaatc ttccacctgc atctcataga tggtagagat gaaatggggt atgggtggct      5640
     gagtgcattt agaaagcagg ttgcctggcc cttgagacca ttttcgtact tggtaccaca      5700
     gtaaaaggaa gtacattaat tagcattaat ccactcatca cctctcagca aagagaaatg      5760
     tccattcctc aaaatgaggt ccacagaacc ttatcacttg gatccttgct agaaatgcag      5820
     gatttcagac cccagcacag acctattaaa tcatcagact cagcatctta acagaatcct      5880
     cacacggatg gaggagaagc aattggctca agctgggggc tcagcctaaa agataaagct      5940
     ccctgctcta agggatgagg ttaagtcaca ggccactttc cagtctggcc ttcattttgt      6000
     gtcccttgct agattatgag aggggcagta gcgttgactg aattgattca tgatatgcct      6060
     agtaccaagg acagggcaac aacatcactg ccccaggact tggcctgtga cctcgtgtgt      6120
     ctttggtgct aattcataaa gcagagtttc cccaagattc ctgctccagc tccagggctc      6180
     ccagtctccc tgatcttaac ttggtgtagg gaagagcaga ggagaggata acagtcatgt      6240
     taaaagccca agtgactaat ggatgtgtct ggtgttcctc tcctagatag cagtgtttga      6300
     ggcagcagag aggcaatgga agttgaaggt ggacaaggaa cagctcagag gagaaaggtg      6360
     tgggggaatc tgagaaggca gaaggccttt tttggaggta ggatggtgaa tctactgaca      6420
     agtgccttct cctatctgtt agctgcttag aacaagggtc agattcactt tgcctggtgc      6480
     atagcagccc ttagcatctg tggactggct gtctgaacaa cagaattgct tagtgcctaa      6540
     tacattgtct gccttagtga ataatgaata aatggacagt attttcttgt ccatccatct      6600
     ttgccattct caaagcgact tgtgggggca taagaaggag aatgaggtag agatggaggc      6660
     aatttttatg cttctcactt gagaaaatgg gtccacctgg acccagcagg cagcaggaaa      6720
     tccagactat gttctctggg aagggagcca caaagaccaa aatgcaaatt ttcttctgct      6780
     tcaaatggtg tggctgccca gcttcctgcc tcctagcatc tgtacacaaa tatcttctca      6840
     attcagaaca ttcccaggga agggaagaac ccacttgcca gcctgaagaa caaagcacgt      6900
     cctctgctct ccattccatt cttgttgcca cagctagaca tctccatctc cgtctccagg      6960
     gtttgagggc attctgggaa atgctagcaa gatcggtgta gatct                      7005
//


spacer
spacer