spacer

EBI Dbfetch

ID   AF140673; SV 1; linear; mRNA; STD; MUS; 3002 BP.
XX
AC   AF140673;
XX
DT   26-SEP-1999 (Rel. 61, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus putative secreted metalloprotease ADAMTS5 (Adamts5) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3002
RX   DOI; 10.1074/jbc.274.36.25555.
RX   PUBMED; 10464288.
RA   Hurskainen T.L., Hirohata S., Seldin M.F., Apte S.S.;
RT   "ADAM-TS5, ADAM-TS6, and ADAM-TS7, novel members of a new family of zinc
RT   metalloproteases. General features and genomic distribution of the ADAM-TS
RT   family";
RL   J Biol Chem 274(36):25555-25563(1999).
XX
RN   [2]
RP   1-3002
RA   Hurskainen T.L., Hirohata S., Seldin M.F., Apte S.S.;
RT   ;
RL   Submitted (06-APR-1999) to the INSDC.
RL   Biomedical Engineering/Wb-3, The Cleveland Clinic Foundation, 9500 Euclid
RL   Avenue, Cleveland, OH 44195, USA
XX
DR   MD5; 041d71aec447e104290d2eba45a18048.
DR   Ensembl-Gn; ENSMUSG00000022894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023611; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3002
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /map="58 cM"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             18..2810
FT                   /codon_start=1
FT                   /gene="Adamts5"
FT                   /product="putative secreted metalloprotease ADAMTS5"
FT                   /note="contains a disintegrin-like and metalloprotease
FT                   domain with thrombospondin type I motifs."
FT                   /db_xref="GOA:Q9R001"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR010294"
FT                   /db_xref="InterPro:IPR013273"
FT                   /db_xref="InterPro:IPR013276"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:1346321"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R001"
FT                   /protein_id="AAD56356.1"
FT                   /translation="MRLEWASLLLLLLLLSASCLSLAADSPAAAPAQDKTRQPQAAAAA
FT                   AEPDQPQGEETRERGHLQPLAGQRRSGGLVHNIDQLYSGGGKVGYLVYAGGRRFLLDLE
FT                   RDDTVGAAGSIVTAGGGLSASSGHRGHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHA
FT                   RYTLKPLLRGSWAEYERIYGDGSSRILHVYNREGFSFEALPPRASCETPASPSGPQESP
FT                   SVHSRSRRRSALAPQLLDHSAFSPSGNAGPQTWWRRRRRSISRARQVELLLVADSSMAR
FT                   MYGRGLQHYLLTLASIANRLYSHASIENHIRLAVVKVVVLTDKDTSLEVSKNAATTLKN
FT                   FCKWQHQHNQLGDDHEEHYDAAILFTREDLCGHHSCDTLGMADVGTICSPERSCAVIED
FT                   DGLHAAFTVAHEIGHLLGLSHDDSKFCEENFGTTEDKRLMSSILTSIDASKPWSKCTSA
FT                   TITEFLDDGHGNCLLDLPRKQILGPEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARL
FT                   WCAVVRQGQMVCLTKKLPAVEGTPCGKGRVCLQGKCVDKTKKKYYSTSSHGNWGSWGPW
FT                   GQCSRSCGGGVQFAYRHCNNPAPRNSGRYCTGKRAIYRSCSVTPCPPNGKSFRHEQCEA
FT                   KNGYQSDAKGVKTFVEWVPKYAGVLPADVCKLTCRAKGTGYYVVFSPKVTDGTECRPYS
FT                   NSVCVRGRCVRTGCDGIIGSKLQYDKCGVCGGDNSSCTKIIGTFNKKSKGYTDVVRIPE
FT                   GATHIKVRQFKAKDQTRFPAYLALKKKTGEYLINGKYMISTSETIIDINGTVMNYSGWS
FT                   HRDDFLHGMGYSATKEILIVQILATDPTKALGVRYSFFVPKKTTQKVNSVISHGSNKVG
FT                   PHSTQLQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLAKGCLLSQRPSAFKQCLLKKC
FT                   "
XX
SQ   Sequence 3002 BP; 726 A; 788 C; 845 G; 643 T; 0 other;
     ccggcgggca gcgcactatg cggctcgagt gggcgtcctt gttgctgcta ctgctgctgc        60
     tgagcgcgtc ctgcctgtcc ctggccgctg acagccccgc cgcggcacct gcccaggata       120
     aaaccaggca gcctcaggct gcagcagcgg ccgccgagcc ggaccagccg cagggggagg       180
     aaacacggga gcgaggccat ttacaaccct tggccgggca gcgcaggagc ggcgggctgg       240
     tccataatat agaccaactc tactctggcg gtggcaaagt gggctacctt gtctacgcgg       300
     gcggccggag gttcctgctg gacctggaga gagatgacac agtgggtgct gctggtagca       360
     tcgttactgc aggaggaggg ctgagcgcat cctctggcca ccggggtcac tgtttctaca       420
     gaggcaccgt ggacggcagc cctcgatccc tagctgtctt tgacctctgc gggggtctcg       480
     atggcttctt tgcagtcaag catgcgcgct acactctaaa gccactcctg cgtgggtcct       540
     gggcagagta tgaacgaatt tatggggatg gatcttcccg catcctgcat gtctacaacc       600
     gcgagggctt tagcttcgag gccctgccgc cacgcgccag ttgcgagact cctgcatccc       660
     catctgggcc ccaagagagc ccctcggtgc acagtagatc taggagacgc tcagcgctgg       720
     ccccgcagct gctggaccac tcagctttct cgccatctgg gaacgcggga cctcagactt       780
     ggtggaggcg taggcgccgt tccatctcca gggcccgcca ggtggagctc ctcttggtgg       840
     ctgactcgtc catggccagg atgtatgggc ggggcctgca gcattacctg ctgaccctgg       900
     cctccatcgc caacaggctg tacagtcatg caagcattga gaaccacatc cgcctggcgg       960
     tggtgaaggt ggtggtgctg acggacaagg acacgagtct ggaggtgagc aagaatgcgg      1020
     ccacgaccct caagaacttt tgcaaatggc agcaccaaca taaccagcta ggggatgatc      1080
     acgaagagca ctacgatgca gccatcctgt tcacccgaga ggatttatgt gggcatcatt      1140
     catgtgacac cctgggaatg gcagacgttg ggaccatatg ttctccggag cgcagctgtg      1200
     cagtgattga agatgatggc ctccatgcag ccttcactgt ggctcatgaa attgggcatc      1260
     tacttggcct ttctcatgac gattccaaat tctgtgaaga gaacttcggt actacagaag      1320
     acaagcgttt aatgtcttca atccttacca gcatcgatgc atccaagccc tggtccaaat      1380
     gcacgtcagc caccatcaca gaattcctgg atgatggtca tggtaattgt ttgctagacc      1440
     taccacggaa gcagattttg ggtcccgagg aactcccagg acagacctac gatgccaccc      1500
     agcagtgcaa cttgacattt gggcctgagt actcggtgtg ccctggcatg gatgtctgtg      1560
     cgcggctgtg gtgtgctgtg gtgcgccaag gccaaatggt gtgtctgacc aagaagctgc      1620
     cggctgtgga gggcactccc tgtgggaagg gaagagtctg ccttcaaggc aaatgtgtgg      1680
     acaaaactaa gaaaaaatat tactcgacat caagccatgg aaattggggg tcctggggcc      1740
     cctggggtca gtgttctcgc tcatgcgggg gaggagtgca gtttgcctac cgccattgta      1800
     ataaccctgc acctcgaaac agtggccgct actgcacagg gaagagggcc atataccgtt      1860
     cctgcagtgt tacaccctgc ccacccaatg gtaaatcttt tcgccatgag cagtgtgaag      1920
     ccaaaaatgg ctatcagtct gatgcaaaag gagtcaaaac atttgtagaa tgggttccca      1980
     aatatgcagg tgtcctgccg gcagatgtgt gcaagcttac ctgcagagct aagggcacag      2040
     gctactatgt ggtcttttct ccaaaggtta cggatgggac tgaatgcagg ccgtacagca      2100
     actctgtgtg tgtccgagga cggtgtgtga gaactggatg tgacggcatt attggctcaa      2160
     agctacaata tgacaagtgt ggagtgtgcg gaggggataa ctccagttgt acaaagatta      2220
     tcggaacctt caataaaaaa agcaagggtt atactgacgt tgtgaggatc cctgaaggag      2280
     caacccacat aaaagtccga cagttcaaag ccaaagacca gactagattc cctgcctact      2340
     tagccctgaa gaagaaaact ggcgagtacc ttatcaatgg caagtacatg atttccactt      2400
     cagagaccat catcgacatc aatggtaccg tcatgaacta cagtggatgg agccacagag      2460
     atgatttttt acatgggatg ggctattcag ccacaaaaga aatcctgatc gtgcagatcc      2520
     ttgccacaga cccaactaaa gcgctaggcg tccgttacag cttttttgtt cccaagaaga      2580
     ccactcaaaa agtaaactct gtcatcagcc atggcagcaa caaggtggga ccacactcta      2640
     cacagctgca gtgggtgaca ggtccatggc tggcctgctc caggacctgt gacacaggct      2700
     ggcacactag gaccgtgcag tgccaggatg gaaacaggaa attagctaaa ggatgccttc      2760
     tctctcagag gccttctgca tttaagcaat gtctgctgaa gaaatgttag cctgtggttt      2820
     actctaatgc acaaaaaaac aacaggagga tcatcgcaga tacagctgtg gtgaagacaa      2880
     ggcctaccca aagcacagaa agtcatgcct tcatgtcatt gtcaccacga gtcgaattat      2940
     gggcagaatc tgctctctgc gaccaaaagg tttactctac ttggtgaatg atggtaccgt      3000
     ga                                                                     3002
//


spacer
spacer