Dbfetch

ID   AF135491; SV 1; linear; mRNA; STD; MUS; 5362 BP.
XX
AC   AF135491;
XX
DT   29-SEP-1999 (Rel. 61, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus clone 16 neuronal apoptosis inhibitory protein (Naip) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5362
RX   DOI; 10.1007/s003359901155.
RX   PUBMED; 10501978.
RA   Huang S., Scharf J.M., Growney J.D., Endrizzi M.G., Dietrich W.F.;
RT   "The mouse Naip gene cluster on Chromosome 13 encodes several distinct
RT   functional transcripts";
RL   Mamm. Genome 10(10):1032-1035(1999).
XX
RN   [2]
RP   1-5362
RA   Dietrich W.F., Huang S.;
RT   ;
RL   Submitted (18-MAR-1999) to the INSDC.
RL   Genetics, HHMI/HMS, 200 Longwood Ave, Boston, MA 02115, USA
XX
DR   MD5; dbba34dc423ad974490a978d1b0b3d81.
DR   Ensembl-Gn; ENSMUSG00000021640; mus_musculus.
DR   Ensembl-Gn; MGP_AKRJ_G0020811; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_CBAJ_G0020586; mus_musculus_cbaj.
DR   Ensembl-Tr; ENSMUST00000022142; mus_musculus.
DR   Ensembl-Tr; MGP_AKRJ_T0037898; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_CBAJ_T0037604; mus_musculus_cbaj.
DR   EuropePMC; PMC310929; 10958634.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5362
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="16"
FT                   /cell_type="primary macrophage"
FT                   /db_xref="taxon:10090"
FT   CDS             113..4324
FT                   /codon_start=1
FT                   /gene="Naip"
FT                   /product="neuronal apoptosis inhibitory protein"
FT                   /db_xref="GOA:Q9QWK5"
FT                   /db_xref="InterPro:IPR001370"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1298223"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QWK5"
FT                   /protein_id="AAD56763.1"
FT                   /translation="MAEHGESSEDRISEIDYEFLPELSALLGVDAVQLAKSQEEEEHKE
FT                   RMKMKKGFNSQMRSEAKRLKTFETYDTFRSWTPQEMAAAGFYHTGVKLGVQCFCCSLIL
FT                   FGNSLRKLPIERHKKLRPECEFLQGKDVGNIGKYDIRVKSPEKMLRGGKARYHEEEARL
FT                   ESFEDWPFYAHGTSPRVLSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFP
FT                   KCEFLQSKKSSEEIAQYIQGYEGFVHVTGEHFVNSWVRRELPMVSAYCNDSVFANEELR
FT                   MDTFKDWPHESPVAVDALVRAGLFYTGKKGIVQCFSCGGCMEKCTEGDDPIQEHNKFFP
FT                   NCVFLQTPKSSAEVIPALQSHCALPEAMETTSESNHDDPAAVHSTVVGLGRSEAQWFQE
FT                   ARSLSEQLRDNYTKATFRHMNLPEVCSSLGTDHLIGCDVSIISKHISQPVQGALTIPEV
FT                   FSNLSSVMCVEGETGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGLAN
FT                   IICAQLLGAGGCISEVCLSSIIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTC
FT                   LLIAVHTNRVRGIRSYLDTSLEIKEFPLSNTVYILKKFFSHNIKRLLKFMVYFGQNEDL
FT                   QGIHKTPLFVAAVCTDWFENPSDQPFQDMALFKSYMQYLSLKHKGAAKPLQATVSSCGQ
FT                   LALTGLFSSCFEFNSDDLAEAGVDEDEELTTCLMSKFTAQRLRPVYRFLGPLFQEFLAA
FT                   MRLTELLSSDRQEDQDLGLYYLRQINSPLKALTTYNNFLKYVFSHPSSKAGPTVVSHLL
FT                   HLVDETELLENTYKNEDYVNHPPGTSRIMKGLKELWLLSPEYYSSFVSEHLLRIALNFA
FT                   YESNTVAECSPFILQFLRGRTLALKVLNLQYFRDHPESLLLVKSLEVSINGNKVPKVVD
FT                   YSVMEKSFETLQPPTIDQDYASAFEQMKEHEKNLSENEETIKSIKNIFPLQPPKISSGY
FT                   WKLSPKPCKIPRLEVGVTNMGPADQALLQVLMEVFSASQSIEFRLSDSSGFLESIRPAL
FT                   ELSKASVTKCSMSRLELSRAEQELLLTLPALQSLEVSETNQLPDQLFHNLHKFLGLKEL
FT                   CVRLDGKPDVLSVLPGEFPNLLHMEKLSIRTSMESDLSKLVKLIQNSPNLHVFHLKCDF
FT                   LSNCDSLMAVLASCKKLREIEFSGRCFEAMPFVNILPNFISLKILNLISQQFPDKETSE
FT                   KFAQALGSLRNLEELLVPTGDGIHQVAKLIVRQCLQLPCLRVLAFHYILDNDSVIEIAR
FT                   VATSGGFQKLEKLDLSMNHKITEEGYRNFFQALDNLPNLQNLNICRHIPECIQVQATTV
FT                   KALGQCVSRLPSLTRLHMLSWLLDEEDMKVINDVKERHPQSKRLIIFWKWIVPFSPVVL
FT                   E"
XX
SQ   Sequence 5362 BP; 1497 A; 1217 C; 1237 G; 1411 T; 0 other;
     gtgaccggta gactctgatc cttctaccaa accttccgtg ccatggtgga atttatccct        60
     tcaaattgaa accacctgag gaagaagcag gagcctgact gaactgaaga aaatggctga       120
     gcatggggag tcctccgagg atcggatttc tgagattgat tatgaatttc tccctgagct       180
     ctctgctctt ctcggggtgg atgcagttca gctggcaaag agccaagaag aagaagagca       240
     taaagaacgg atgaaaatga agaaaggttt taactcacag atgcgcagtg aagccaaacg       300
     actaaagacc tttgagacct atgacacgtt cagatcatgg acgccacagg agatggcagc       360
     tgctgggttt taccacacag gggtgaaact tggggttcag tgcttttgct gtagcttgat       420
     cctctttggc aatagcctca ggaagcttcc catagagaga cacaagaaat tacgtccaga       480
     atgtgagttc cttcagggaa aagatgttgg taacattggc aagtatgaca tccgggtgaa       540
     gagtccagag aagatgctga gaggtggcaa agccaggtac catgaagagg aggccagact       600
     ggagtccttt gaggactggc cattttatgc ccatgggaca tcaccacgtg tactctcagc       660
     agctggcttt gtctttacag gtaaaaggga cactgtgcag tgtttttcct gtggcggaag       720
     cttgggcaac tgggaagaag gagatgaccc ctggaaggag catgccaagt ggttccccaa       780
     atgtgaattt cttcaaagta agaaatcttc agaggaaatt gcccagtata tccaaggcta       840
     tgagggattt gttcatgtaa cgggagaaca ttttgtgaat tcctgggtca gaagagaatt       900
     acctatggta tcagcttact gcaacgacag cgtcttcgct aatgaagaac taaggatgga       960
     cacgtttaag gactggcccc acgaatcacc tgtggctgtt gatgctttgg tcagagctgg      1020
     ccttttctac acaggcaaaa agggcattgt ccagtgtttt tcctgtggag gatgtatgga      1080
     gaagtgcaca gaaggtgacg acccaataca agagcacaac aagttttttc ccaactgtgt      1140
     atttctccaa accccgaagt cctctgcaga agtgattcca gcccttcaga gccactgtgc      1200
     acttccagaa gccatggaaa ccacaagtga aagcaaccac gatgatccag cagcagttca      1260
     ttctacagtg gtgggcttgg gtaggagtga agcccagtgg tttcaagagg ccaggagtct      1320
     gagtgagcag ctaagagaca actacactaa agccactttt cgccacatga acttgccaga      1380
     agtgtgctcc agccttggca ctgaccactt gatcggctgc gatgtgtcca tcatttcaaa      1440
     gcacatcagc cagcctgtgc aaggggccct gacgatccct gaggtcttct ccaatctcag      1500
     ctctgtcatg tgtgtggagg gggaaactgg cagtggaaag acaaccttcc tgaagaggat      1560
     agcttttctc tgggcatcag gatgctgccc cttgttgtac aggttccagc tggtcttcta      1620
     cctctccctt agttccatca caccagacca gggactggcc aacatcatct gtgcccaact      1680
     cctaggggca ggaggctgca ttagtgaagt gtgtctgagc agcatcatcc agcagttaca      1740
     acaccaggtg ctgttcctgt tggatgacta cagtgggctg gcctcactcc cccaagccct      1800
     acatacactg attacaaaaa actacttgtc acggacctgc ttattgatcg ctgtgcatac      1860
     aaacagggtc aggggcatcc gctcatacct agatacgagt ctagagatca aagagtttcc      1920
     cttgtccaat actgtctata tattaaagaa gttcttctcc cataatataa aacgtctact      1980
     aaagtttatg gtttattttg gacagaatga agatttacag ggaattcaca agacccccct      2040
     cttcgtggca gcagtatgta ctgactggtt tgaaaatcca tctgaccagc cctttcagga      2100
     tatggcactt ttcaagtcct acatgcaata cctgtcctta aagcacaaag gtgcagctaa      2160
     gcctctccaa gccaccgtgt cctcatgtgg gcagctggcc ttgacagggc ttttctcatc      2220
     atgctttgag ttcaatagtg atgacctggc agaggcagga gttgatgaag atgaagagct      2280
     caccacctgc ttgatgagca aattcaccgc ccagagactg aggccagtct accggttttt      2340
     aggtccgctg ttccaggagt ttcttgctgc catgagactg actgaacttc tgagttcaga      2400
     taggcaggaa gaccaagatc tgggacttta ttatttgaga caaattaact cacccttgaa      2460
     ggctttgacc acctacaaca attttttgaa gtatgtcttt agccatccgt catcaaaggc      2520
     agggccaaca gttgtatctc atttgcttca cttggtggat gagacagagt tgctggagaa      2580
     tacctataaa aatgaggatt atgtaaatca ccctccagga acttcccgaa taatgaaggg      2640
     acttaaggaa ctgtggctgt tatctcctga atattactct tcatttgttt cagaacattt      2700
     attgcgcatt gctctaaact ttgcttatga aagcaacact gttgctgaat gttctccatt      2760
     tattttgcag ttccttagag ggagaacact ggctttgaaa gtactgaatt tacaatactt      2820
     tagggaccac ccagaaagcc tgttactggt gaagagttta gaagtctcga taaatggaaa      2880
     taaagtgcca aaagttgtag attattcagt catggaaaaa agttttgaaa cattacagcc      2940
     accaactata gatcaggact atgcatccgc ctttgaacaa atgaaggaac atgaaaaaaa      3000
     tttatctgaa aatgaagaga ccataaagag tattaagaac atcttcccct tacagccacc      3060
     taaaataagc tctggctatt ggaaactgtc ccccaagcca tgcaagatcc ctaggctgga      3120
     agttggagtg accaacatgg gtccagcaga tcaagcactg ctccaggtcc tcatggaagt      3180
     cttctcagct tcacagagta ttgagttccg tttatccgac agcagtggct tccttgaaag      3240
     catccgccca gctctggagc tgagtaaggc ctctgtcacc aagtgttcca tgtccaggct      3300
     ggagctcagc agagcagaac aggagctgct tctcaccctg cctgccctgc agtctctcga      3360
     ggtctcagag acaaaccagt taccagatca gctcttccat aacttgcaca agttcctggg      3420
     cctgaaagaa ctgtgtgtga gactagatgg caaaccggat gtgctctcag tccttcctgg      3480
     agagttccca aacctccttc acatggagaa gttatccatc cgaacctcca tggagtctga      3540
     cctctccaaa ctagttaaat tgattcagaa ctctccaaat ctccatgttt tccatctgaa      3600
     atgtgatttc ctttcgaatt gtgactctct catggctgtg cttgcttcct gcaagaaact      3660
     cagagagatt gagttttctg gacgatgctt tgaagccatg ccctttgtta acattttgcc      3720
     aaattttatt tctctgaaga tattaaatct tataagccaa caattcccag ataaggaaac      3780
     atcagaaaag tttgcccagg ctctgggttc tctcaggaac ctggaggaac tgctcgttcc      3840
     cactggagac gggattcacc aagtggccaa attgattgtc cggcagtgtc tgcagcttcc      3900
     gtgtctccga gttcttgcct ttcactacat cttggacaat gacagtgtga ttgaaattgc      3960
     cagggtggca accagtggag gtttccagaa actcgagaag ttagatcttt ccatgaatca      4020
     caagattacc gaggaaggat atagaaattt ctttcaagcc ctggacaacc tgccaaactt      4080
     gcagaatctg aacatctgca gacatatccc agaatgcatt caagttcagg ccaccactgt      4140
     caaggctctg ggtcaatgtg tgtcccgact gcccagcctc actaggctgc acatgctcag      4200
     ttggctcctg gatgaagagg acatgaaagt gattaatgat gtgaaggaaa gacaccccca      4260
     gtccaaacgc ttgattatct tctggaaatg gatagtcccg ttctctcctg ttgtcctgga      4320
     gtaaaggatg ctcctgaaga ctactgatag ttcagaatac cagatttcct aaaacacttt      4380
     actttagctg ggcatggtgg tacacacctg tactttcaac atttaggaca ctgatgtgca      4440
     agaatcaaga agttcagacc agatccagtt tcacagctaa agacacaact atccatccta      4500
     ctaaagaata tttattaagt gtgcagactg ctaatttttt ttcagaagtc tgcatgccca      4560
     ctattgaatt cagtagctat attgctcaat gccttggcag tccttatttg gtcttcctgt      4620
     ctgaagacta gagcctcagt cacgttcata tagagaactg tcaatgccaa ggtcaacagg      4680
     aaaggcgctg ggaaaggaac atcgatctat gtagaagcca catccggaag tagtatttga      4740
     taggtgctgg ggtagtgcaa gaggaacagc aaaacagctt tagaactcac ggaacgcagt      4800
     ctcctggtta gcacaaactc atgggtgggt ctccgagaga actatgggtc ctgagagctt      4860
     catggtgtca tagagatttg ctctgcttgc tgccttctca ctgtgttact cataatctat      4920
     gagttttatg aactctctag ggggcttaac aacccctcac tgggcagtgt cattgtcact      4980
     cacagcagca gtgcttgatc ttcaagatca atgattcaat caccaccctt ggaaagaact      5040
     tagaaatgta cattgttaga aatgaccacc agtcttaaga atttggagaa gtagattgtc      5100
     agtaaagtta ggttaagatg tttttgttaa tggctctgat gttgaaaaat cttagaaatc      5160
     aaatagaaat tcagaaaagc ccacttttga ttattgatca agggatgttt tcaagatcag      5220
     gaacaagaac aatggcagct cagctagcac tggctgatgt gactcttgct gaagctgggc      5280
     tgatgatcga ggtgataatt aatgtcttgt acccaatgtt cccctcacct ttctgataag      5340
     atttaataaa aagttgtccc cg                                               5362
//