spacer

EBI Dbfetch

ID   AF134158; SV 1; linear; mRNA; STD; MUS; 1362 BP.
XX
AC   AF134158;
XX
DT   02-AUG-1999 (Rel. 60, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus serotonin 6 receptor mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1362
RX   DOI; 10.1016/S0169-328X(01)00090-0.
RX   PUBMED; 11406289.
RA   Kohen R., Fashingbauer L.A., Heidmann D.E.A., Guthrie C.R., Hamblin M.W.;
RT   "Cloning of the mouse 5-HT6 serotonin receptor and mutagenesis studies of
RT   the third cytoplasmic loop";
RL   Brain Res. Mol. Brain Res. 90(2):110-117(2001).
XX
RN   [2]
RP   1-1362
RA   Kohen R., Hamblin M.W.;
RT   ;
RL   Submitted (10-MAR-1999) to the INSDC.
RL   GRECC (182B), Veterans Affairs Puget Sound Health Care System, 1660 South
RL   Columbian Way, Seattle, WA 98108, USA
XX
DR   MD5; 46e5088a8c3ccb729f2a8f5eee6330af.
DR   Ensembl-Gn; ENSMUSG00000028747; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105802; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1362
FT                   /organism="Mus musculus"
FT                   /strain="129/SvJ"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             29..1351
FT                   /codon_start=1
FT                   /product="serotonin 6 receptor"
FT                   /note="5-HT6 receptor"
FT                   /db_xref="GOA:Q9R1C8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1196627"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R1C8"
FT                   /protein_id="AAD46490.1"
FT                   /translation="MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANS
FT                   LLIALICTQPALRNTSNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTA
FT                   FDVMCCSASILNLCLISLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLL
FT                   LGWHELGKARTSAPGQCRLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQV
FT                   ASLTTGTATAGQALETLQVPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFV
FT                   TWLPFFVASIAQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCV
FT                   HCPPEHRASPASPSMWTSHSGARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLL
FT                   LPGEATRDPPPPTRAPTVVNFFVTDSVEPEIRQHPLGSPMN"
XX
SQ   Sequence 1362 BP; 206 A; 492 C; 377 G; 287 T; 0 other;
     cctgtcctgg tcctcaaccc tagtccccat ggttccagag cccggccctg tcaacagtag        60
     caccccagcc tggggccccg ggccaccgcc agccccaggg ggcagcggct gggtggccgc       120
     tgcgctgtgc gtggtcatcg tactgacggc agccgccaat tcgctgctga tcgcgctcat       180
     ctgcacgcag cccgcgctgc gcaacacgtc taacttcttc ctggtgtcgc tcttcacgtc       240
     ggacctgatg gtgggattgg tggtgatgcc cccagccatg ctgaacgcgc tgtatgggcg       300
     ctgggtgcta gctcgcggcc tctgtctgct ttggaccgcc ttcgacgtga tgtgctgcag       360
     cgcctccatt ctcaacctct gcctcatcag cctggaccgc tacctgctca tcctctcgcc       420
     gctgcgctac aagctgcgca tgacagcccc gcgtgccctg gcgctcatcc tgggtgcctg       480
     gagcctcgcc gcgctggcct ccttcctgcc cctcttgctg ggctggcatg aactgggcaa       540
     agctcgaaca tctgccccgg gccagtgccg cctattggcc agcctgcctt atgtcctcgt       600
     ggcgtccggc gtcacctttt tcctgccttc gggtgccatc tgcttcacct actgcaggat       660
     cttgctggct gcccgcaagc aggcggtgca agtggcctcg ctcaccacgg gcacggctac       720
     ggctggccag gccttggaaa ccttgcaggt gcccaggaca ccacgcccag ggatggagtc       780
     tgctgacagt aggcgtctga ccaccaagca tagcaggaag gccttgaagg ccagcctgac       840
     cctcggcatc ctgctgagca tgttctttgt cacctggctg cccttctttg tggccagcat       900
     agctcaggcc gtatgtgact gcatctctcc aggtctcttc gatgtcctca catggctggg       960
     atactgtaat agcaccatga accctatcat ctatcccctc ttcatgcggg acttcaagag      1020
     ggccctgggc aggttcgtgc cgtgtgtcca ctgtcccccg gagcaccggg ccagccccgc      1080
     ctccccctcc atgtggacct ctcacagtgg tgccaggcca ggcctcagcc tgcagcaggt      1140
     gctgcccctg cctctgccac ccaactcaga ttcagactca gcttcagggg gcacctcggg      1200
     cctgcagctc acagcccagc ttttgctgcc tggagaggcg acccgggacc ccccgccacc      1260
     caccagggcc cctactgtgg tcaacttctt cgtcacagac tctgtggagc ctgagatacg      1320
     gcagcatcca cttggttccc ccatgaactg accaggtcaa ga                         1362
//


spacer
spacer