spacer

EBI Dbfetch

ID   AF133817; SV 1; linear; mRNA; STD; MUS; 713 BP.
XX
AC   AF133817;
XX
DT   11-MAY-1999 (Rel. 59, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus insulin-like peptide INSL5 (Insl5) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-713
RX   DOI; 10.1006/geno.1999.5899.
RX   PUBMED; 10458910.
RA   Conklin D., Lofton-Day C.E., Haldeman B.A., Ching A., Whitmore T.E.,
RA   Lok S., Jaspers S.;
RT   "Identification of INSL5, a new member of the insulin superfamily";
RL   Genomics 60(1):50-56(1999).
XX
RN   [2]
RP   1-713
RA   Conklin D., Lofton-Day C., Haldeman B., Ching A., Whitmore T., Lok S.,
RA   Jaspers S.;
RT   ;
RL   Submitted (09-MAR-1999) to the INSDC.
RL   ZymoGenetics, Inc., 1201 Eastlake Ave. E., Seattle, WA 98102, USA
XX
DR   Ensembl-Gn; ENSMUSG00000066090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084382; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106869; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..713
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             40..447
FT                   /codon_start=1
FT                   /gene="Insl5"
FT                   /product="insulin-like peptide INSL5"
FT                   /db_xref="GOA:Q9WUG6"
FT                   /db_xref="InterPro:IPR016179"
FT                   /db_xref="InterPro:IPR022353"
FT                   /db_xref="MGI:MGI:1346085"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUG6"
FT                   /protein_id="AAD29687.1"
FT                   /translation="MKGPTLALFLLLVLLAVVEVRSRQTVKLCGLDYVRTVIYICASSR
FT                   WRRHLEGHFHSQQAETRNYLQLLDRHEPSKKTLEHSLPKTDLSGQELVRDPQAPKEGLW
FT                   ELKKHSVVSRRDLQALCCREGCSMKELSTLC"
FT   polyA_signal    664..669
FT                   /gene="Insl5"
XX
SQ   Sequence 713 BP; 197 A; 182 C; 157 G; 177 T; 0 other;
     atggctgacc acattgcttc tcatttgctc tccggcagga tgaagggccc cactcttgct        60
     ctgtttctcc tcttagttct gttggctgtg gtggaagtaa gaagcaggca gactgtgaag       120
     ctctgtggcc tggactacgt gagaacagtt atctacatct gtgccagctc acggtggagg       180
     agacatctgg aggggcattt ccactctcaa caagctgaga caagaaacta cctccagctc       240
     ctagacaggc acgagccatc caagaaaact ctggagcaca gccttcccaa gacggatctc       300
     tcaggacagg agcttgttcg agatccacag gcacccaagg aaggtctttg ggaactgaag       360
     aagcactcag tggtatccag acgagatctg caagctctgt gctgcaggga aggctgctcc       420
     atgaaggaac tcagcaccct ctgttaggat gcgcccaacc ccttggcagg cttcagcatg       480
     catctcaatg ttctaccatc gagttccctg ttcagcttct atcactacaa ccacggcttt       540
     tgatcctttc cttaaaggtc tattatggct taaagccact cttctccctg tgctgaggtc       600
     aatctacttt tctttctaaa ttctaactac tgctttgaag tttcgagtgc tgtgcaaaat       660
     tgcaataaaa aaaaatgcct gaatccaaaa aaaaaaaaaa aaaaaaaaaa aaa              713
//


spacer
spacer