spacer

EBI Dbfetch

ID   AF129086; SV 1; linear; mRNA; STD; MUS; 1218 BP.
XX
AC   AF129086;
XX
DT   01-JUN-1999 (Rel. 59, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus carboxy terminus of Hsp70-interacting protein (Chip) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1218
RX   PUBMED; 10330192.
RA   Ballinger C.A., Connell P., Wu Y., Hu Z., Thompson L.J., Yin L.Y.,
RA   Patterson C.;
RT   "Identification of CHIP, a novel tetratricopeptide repeat-containing
RT   protein that interacts with heat shock proteins and negatively regulates
RT   chaperone functions";
RL   Mol. Cell. Biol. 19(6):4535-4545(1999).
XX
RN   [2]
RP   1-1218
RA   Ballinger C., Patterson C.;
RT   ;
RL   Submitted (18-FEB-1999) to the INSDC.
RL   Sealy Center for Molecular Cardiology, University of Texas Medical Branch,
RL   301 University Boulevard, Galveston, TX 77555-1064, USA
XX
DR   MD5; 6a6ac4500d643569c8b6a1c931fc7d2a.
DR   Ensembl-Gn; ENSMUSG00000039615; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044911; mus_musculus.
DR   EuropePMC; PMC104411; 10330192.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1218
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             56..970
FT                   /codon_start=1
FT                   /gene="Chip"
FT                   /product="carboxy terminus of Hsp70-interacting protein"
FT                   /note="tetratricopeptide repeat protein; CHIP"
FT                   /db_xref="GOA:Q9WUD1"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1891731"
FT                   /db_xref="PDB:2C2L"
FT                   /db_xref="PDB:2C2V"
FT                   /db_xref="PDB:3Q47"
FT                   /db_xref="PDB:3Q49"
FT                   /db_xref="PDB:3Q4A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUD1"
FT                   /protein_id="AAD33401.1"
FT                   /translation="MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPE
FT                   AAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQC
FT                   QLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELH
FT                   SYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEK
FT                   RKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQL
FT                   IPNLAMKEVIDAFISENGWVEDY"
XX
SQ   Sequence 1218 BP; 262 A; 333 C; 388 G; 235 T; 0 other;
     gggctgcgag atctaggtgg ccgggcgcgg agcccaagcc gtgccgcgcg gcgccatgaa        60
     gggcaaggag gaaaaggagg gcggcgcgcg gctgggcact ggtggcggcg gcagccctga       120
     taagagcccg agtgcgcaag agctcaagga gcagggaaac cggctcttcg tgggccgcaa       180
     gtacccggag gcggcggcct gctacggccg cgccatcact cggaacccac ttgtggcagt       240
     gtactacacc aaccgggccc tgtgctatct gaagatgcag cagcctgaac aggcacttgc       300
     tgactgccgg cgagccctgg agctggacgg gcagtctgtg aaggcgcact tcttcctggg       360
     gcagtgccag ctggagatgg agagttatga tgaggccatt gccaatctgc agcgagccta       420
     tagtttggcc aaggagcagc gactcaactt tggggatgat attcctagtg cccttcgcat       480
     tgctaagaag aagcgctgga acagtatcga ggaacggcgc atccaccagg agagtgagct       540
     gcattcatat ctcaccaggc tcattgctgc tgagcgagag agggaactgg aggagtgtca       600
     gcggaaccac gagggtcatg aagatgatgg ccacatccgg gcccagcagg cctgcattga       660
     ggccaagcac gataaataca tggcagatat ggatgagctc ttctctcagg tggacgagaa       720
     aagaaagaag cgagatatcc ctgactactt gtgtggcaag attagctttg agctgatgcg       780
     ggaaccctgc attacaccca gtggtatcac ctatgaccgc aaggacattg aggagcacct       840
     gcagcgtgtg ggccactttg accctgtgac ccggagccct ctgacccagg aacagctcat       900
     ccccaacttg gccatgaagg aagtcattga cgctttcatc tctgagaacg gctgggtaga       960
     ggactattga ggccccatgt cctgcctggc accctggccc aggaggatct ggagacggaa      1020
     gctccagtcc ctgtatagtt tgtgtccctg ggcctgcccc catcggccct gctgatgggt      1080
     tctgaactgc tccccttctc agcatacccc ttgctggacc atgagcctcc cttgtccccc      1140
     ttctgggctg gagagtgggt gagggtgggc tgaggttgct gctgctgcca ctgtcctgta      1200
     ataaagtctg tgagcact                                                    1218
//


spacer
spacer