spacer

EBI Dbfetch

ID   AF126469; SV 1; linear; mRNA; STD; MUS; 1144 BP.
XX
AC   AF126469;
XX
DT   01-JAN-2002 (Rel. 70, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus KOR-3D mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1144
RA   Pan Y.-X., Xu J., Pasternak G.W.;
RT   "Identification of a splice variant, KOR-3D, of kappa3-related opioid
RT   receptor (KOR-3) gene";
RL   Unpublished.
XX
RN   [2]
RP   1-1144
RA   Pan Y.-X., Xu J., Pasternak G.W.;
RT   ;
RL   Submitted (05-FEB-1999) to the INSDC.
RL   Neurology, Memorial Sloan-Kettering Cancer Center, 1275 York Ave., New
RL   York, NY 10021, USA
XX
DR   MD5; 141f9d3f4936a79862c4a1c32ad32610.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1144
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /map="A5-B2"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             21..1109
FT                   /codon_start=1
FT                   /product="KOR-3D"
FT                   /note="splice variant of KOR-3 gene"
FT                   /db_xref="GOA:P35377"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35377"
FT                   /protein_id="AAL54889.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMHTKMKTATNIYIFNLALADTLVLLTLPFQGTDIL
FT                   LGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVN
FT                   VAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFIIPVLI
FT                   ISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLVQGLG
FT                   VQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREMQVSDR
FT                   VRSIAKDVGLGCKTSETVPRPA"
XX
SQ   Sequence 1144 BP; 209 A; 320 C; 301 G; 314 T; 0 other;
     tggctttgca gggtgacagc atggagtccc tctttcctgc cccattctgg gaggtcttgt        60
     atggcagcca ctttcaaggg aacctgtctc tcctaaatga gaccgtaccc catcacctgc       120
     tcctcaatgc tagccacagt gccttcctgc cccttggact caaggtcacc atcgtggggc       180
     tctacttggc tgtgtgcatc ggggggctcc tggggaactg cctcgtcatg cacaccaaga       240
     tgaagactgc taccaacatt tacatattta atctggcact ggctgatacc ctggtcttgc       300
     tgacactgcc cttccagggc acagacatcc ttctgggctt ctggccattt gggaatgcac       360
     tgtgcaagac ggtcattgct atcgactact acaacatgtt taccagcact ttcactttga       420
     ctgccatgag tgtagaccgt tatgtagcta tctgccaccc tatccgtgcc cttgatgttc       480
     ggacatccag taaagcccag gccgttaatg tggccatatg ggccctggct tcggtggttg       540
     gtgttcctgt tgccatcatg ggctcagcac aagtggagga tgaagagatc gagtgcctgg       600
     tggagatccc cgcccctcag gactattggg gccctgtatt tgccatctgc atcttccttt       660
     tttccttcat catcccggtt ctgatcatct ctgtctgcta cagcctcatg attcgacgac       720
     ttcgtggtgt ccggctgctt tcaggctccc gagagaagga ccggaacctg cgacgcatca       780
     cacggctggt actggtagtt gtggctgtgt ttgtgggctg ctggacacct gtgcaggtct       840
     ttgtcctggt tcaaggactg ggtgttcagc caggtagtga gactgcagta gccattctgc       900
     gcttctgcac agccctgggc tatgtcaaca gttgtctcaa tcccattctc tatgctttct       960
     tggatgagaa cttcaaggcc tgctttagaa agttctgctg tgcttctgcc ctgcaccggg      1020
     agatgcaggt ttctgatcgt gtgcgcagca ttgccaagga tgtaggcctt ggttgcaaga      1080
     cctctgagac agtaccacgg ccggcatgac taggcgtgga cctgcccatg gtgcctgtca      1140
     gtcc                                                                   1144
//


spacer
spacer