spacer

EBI Dbfetch

ID   AF126294; SV 1; linear; mRNA; STD; MUS; 1912 BP.
XX
AC   AF126294;
XX
DT   18-JUN-1999 (Rel. 60, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus strain ICR/Hsd phosphoinositide-dependent protein kinase 1
DE   mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1912
RA   Park J., Hemmings B.A.;
RT   "Mouse phosphoinositide-dependent protein kinase 1 (mPDK1)";
RL   Unpublished.
XX
RN   [2]
RP   1-1912
RA   Park J., Hemmings B.A.;
RT   ;
RL   Submitted (06-FEB-1999) to the INSDC.
RL   Friedrich Miescher Institute, Maulbeerstrasse 66, Basel CH 4058,
RL   Switzerland
XX
DR   MD5; 90b3a4a3ccb20f21970ca8d6847096fe.
DR   Ensembl-Gn; ENSMUSG00000024122; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102927; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1912
FT                   /organism="Mus musculus"
FT                   /strain="ICR/Hsd"
FT                   /mol_type="mRNA"
FT                   /dev_stage="newborn"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             76..1755
FT                   /codon_start=1
FT                   /product="phosphoinositide-dependent protein kinase 1"
FT                   /note="PDK1"
FT                   /db_xref="GOA:Q9Z2A0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1338068"
FT                   /protein_id="AAD38505.1"
FT                   /translation="MARTTSQLYDAVPIQSSVVLCSCPSPSMVRSQTEPGSSPGIPSGV
FT                   SRQGSTMDGTTAEARPSTNPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARE
FT                   LATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLS
FT                   YAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHI
FT                   QITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAG
FT                   LPPFRAGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLK
FT                   AHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHS
FT                   LSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENN
FT                   LILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTF
FT                   FVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQQYQSNPDAAVQ"
XX
SQ   Sequence 1912 BP; 530 A; 477 C; 457 G; 448 T; 0 other;
     ttcggcacga ggacgctgag gaggcgccga gcagcgcaac gctgcggggg aggcgcccgc        60
     gccgacttgg ggctcatggc caggaccacc agccagctgt atgacgctgt gcccattcag       120
     tccagtgtgg tgctatgttc ctgcccatcc ccatcaatgg tgaggtccca gactgagccc       180
     ggttcgtccc ctggcattcc tagtggtgtt agcaggcagg gatccaccat ggatggcacc       240
     acagctgaag cccgaccaag caccaacccc ttgcagcagc accctgccca gctgccacca       300
     cagcctcgca agaaacgccc tgaagacttc aagtttggga aaattcttgg cgagggctct       360
     ttttcaacag ttgttctggc ccgagaactg gccacttcca gagaatatgc tattaaaatt       420
     ctggagaaac gtcatattat aaaagaaaac aaagttccgt atgtaactag agagagagat       480
     gtgatgtcac gcctggatca ccccttcttt gtgaaacttt attttacatt tcaggacgac       540
     gaaaagctgt attttggcct tagttatgcc aaaaatggag agctacttaa atacatccgc       600
     aaaattggct catttgatga gacctgtacc cggttttaca cggctgagat tgtgtctgct       660
     ttagagtact tgcatggcaa gggcatcatt cacagagacc ttaaaccaga aaacattttg       720
     ttaaatgaag acatgcacat ccagatcaca gattttggaa cagcaaaagt gttatcccca       780
     gagagcaaac aagccagggc caactcattt gtaggaacag cacagtatgt ttctccagag       840
     ctgctcacag agaagtcggc gtgtaaaagt tcagaccttt gggcccttgg atgtataatc       900
     tatcagctcg tggcaggact cccaccattc agagccggga atgaatatct tatatttcag       960
     aagatcatta agctggaata tcatttccca gaaaaattct tccctaaggc tagagatctt      1020
     gtggaaaaac tcttggtttt agatgccaca aagcgtttag gctgtgaaga gatggaaggg      1080
     tacgggcctc tcaaagctca tccattcttt gagaccatca cttgggagaa tttgcaccag      1140
     cagacacctc cgaagctcac agcttaccta ccagccatgt cagaggatga tgaagactgc      1200
     tatggcaact acgacaatct cctgagccag tttggcttca tgcaggtgtc atcctcctcc      1260
     tcttcccact ccctgtctac ggtggaaacc agcctgcccc agaggtcggg cagcaacata      1320
     gagcagtaca tccatgattt ggacactaac tcttttgaac tagacttaca gttttcagaa      1380
     gatgaaaaaa ggttgttatt ggaaaagcaa gccggtggaa acccttggca ccagtttgta      1440
     gaaaataatc taatattaaa aatgggtcca gtggataagc gaaagggttt atttgcaaga      1500
     cgacgacagt tattactcac agaagggcca catttatatt atgttgatcc tgtcaacaag      1560
     gtcttgaaag gtgaaatccc atggtcacaa gaactccgac cagaagccaa gaattttaaa      1620
     actttctttg tccacacgcc taacaggacg tactacctga tggatccaag cgggaatgct      1680
     cacaagtggt gcagaaagat ccaggaggtt tggaggcagc agtaccagag caatccagat      1740
     gctgctgtgc agtgacgtgg cctgcggccg ggctgcctat tgctgccagg atacctgccc      1800
     cagcgcggct cggccgccac ccaggacgct tccagaccac ctgccagcca tctcgtggag      1860
     aacatagatg gcagaaacct tgcagctttt ttatttaaaa actcgtgccg aa              1912
//


spacer
spacer