Dbfetch

ID   AF120255; SV 1; linear; mRNA; STD; MUS; 2535 BP.
XX
AC   AF120255;
XX
DT   05-NOV-2000 (Rel. 65, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus gamma-aminobutyric acid B receptor 1b (GabaBr1b) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2535
RX   PUBMED; 11306808.
RA   Lamp K., Humeny A., Nikolic Z., Imai K., Adamski J., Schiebel K.,
RA   Becker C.-M.;
RT   "The murine GABA(B) receptor 1: cDNA cloning, tissue distribution,
RT   structure of the Gabbr1 gene, and mapping to chromosome 17";
RL   Cytogenet. Cell Genet. 92(1-2):116-121(2001).
XX
RN   [2]
RP   1-2535
RA   Lamp K., Humeny A., Nikolic Z., Becker C.-M.;
RT   ;
RL   Submitted (14-JAN-1999) to the INSDC.
RL   University Erlangen, Biochemistry, Fahrstr. 17, Erlangen 91054, Germany
XX
DR   MD5; 764f4394c18e4261556ecb12d756c97e.
DR   Ensembl-Gn; ENSMUSG00000024462; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023695; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023653; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023624; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023660; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023422; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024098; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022907; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023399; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023524; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023497; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023602; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023520; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024143; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022659; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022974; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000025338; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172792; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0047663; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0047643; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0047604; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0047610; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0047342; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048093; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0047404; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0047276; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0047375; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0047343; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0047477; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0047351; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048188; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0046991; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0046665; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2535
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..2535
FT                   /codon_start=1
FT                   /gene="Gababr1b"
FT                   /product="gamma-aminobutyric acid B receptor 1b"
FT                   /note="GABABR1b"
FT                   /db_xref="GOA:Q9WV18"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR002455"
FT                   /db_xref="InterPro:IPR002456"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1860139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WV18"
FT                   /protein_id="AAG29341.1"
FT                   /translation="MGPGGPCTPVGWPLPLLLVMAAGVAPVWASHSPHLPRPHPRVPPH
FT                   PSSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCD
FT                   PGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRF
FT                   PTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITF
FT                   RQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYAD
FT                   NWFKTYDPSINCTVEEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRH
FT                   PEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSS
FT                   SFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPA
FT                   DQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTA
FT                   VGCSLALAAVFPLGLDGYHIGRSQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFT
FT                   KKEEKKEWRKTLEPWKLYATVGLLVGMDILTLAIWQIVDPLHRTIETFAKEEPKEDIDV
FT                   SILPQLEHCSSKKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYN
FT                   VPVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEA
FT                   QDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQIRSRRHPP
FT                   TPPDPSGGLPRGPSEPPDRLSCDGSRVHLLYK"
XX
SQ   Sequence 2535 BP; 578 A; 718 C; 666 G; 573 T; 0 other;
     atgggcccgg ggggaccctg taccccggtg gggtggccgc tgcctcttct gctggtgatg        60
     gcggctgggg tggctccggt gtgggcctct cactcccctc atctcccgcg gcctcacccg       120
     agggtccccc cgcacccctc ctcagaacgg cgtgcagtat acatcggggc gctgtttccc       180
     atgagcgggg gctggccggg gggccaggcc tgccagcctg cggtggagat ggcgctggag       240
     gacgttaaca gccgcagaga catcctgccg gactacgagc tcaagcttat ccaccacgac       300
     agcaagtgcg acccagggca agccaccaag tacttgtatg aactactcta caacgacccc       360
     atcaagatca tcctcatgcc cggctgcagc tctgtgtcca cactggtagc cgaggctgcc       420
     cggatgtgga accttattgt gctctcatat ggctccagct caccagcctt gtcaaaccga       480
     cagcggtttc caacgttctt tcggacacat ccatccgcca cactccacaa tcccacccgg       540
     gtgaaactct tcgaaaagtg gggctggaag aagattgcca ccatccagca gactaccgag       600
     gtcttcacct caacactgga tgacctggag gagcgagtga aagaggctgg gattgagatc       660
     acttttcgac agagtttctt ctcagatcca gctgtgcctg ttaaaaacct gaagcgtcaa       720
     gatgctcgaa tcatcgtggg acttttctat gagaccgaag cccggaaagt tttttgtgag       780
     gtctataagg aacggctctt tgggaagaag tatgtctggt ttctcatcgg gtggtatgct       840
     gacaactggt tcaaaaccta tgacccgtca atcaattgta cagtagaaga gatgactgag       900
     gcggtggagg gccatatcac cacggagatt gtcatgctga accctgccaa cacccgaagc       960
     atttccaaca tgacatcaca ggaatttgtg gagaaactaa ccaagcggct gaaaagacac      1020
     cctgaggaga ctggaggctt ccaggaggca ccactggcct atgatgctat ctgggccttg      1080
     gctttggcct tgaacaagac ctctggagga ggtggccgtt caggagtgcg cctggaggac      1140
     tttaactaca acaaccagac cattacagac caaatctacc gggccatgaa ctcctcctcc      1200
     tttgagggtg tttctggcca cgtggtcttt gatgccagcg gctcccggat ggcatggacg      1260
     cttatcgagc agctacaggg cggcagctac aagaagatcg gctactacga cagcaccaag      1320
     gatgatcttt cctggtccaa aacagacaag tggatcggag ggtctccccc agccgaccag      1380
     accttggtca tcaagacatt ccgtttcctg tcacagaaac tctttatctc cgtctcagtt      1440
     ctctccagcc tgggcattgt tcttgctgtt gtctgtctgt cctttaacat ctacaactcc      1500
     cacgttcgtt atatccagaa ctcccagccc aacctgaaca atctgactgc tgtgggctgc      1560
     tcactggcac tagctgctgt cttccccctt gggctggatg gttaccacat agggagaagc      1620
     cagttcccat ttgtctgcca ggcccgcctt tggctcttgg gcttaggctt tagtctgggc      1680
     tatggctcta tgttcaccaa gatctggtgg gtccacacag tcttcacaaa gaaggaggag      1740
     aagaaggaat ggaggaagac cctagagcct tggaaactgt acgccactgt aggcctgctg      1800
     gtgggcatgg atatcctgac tcttgccatc tggcagattg tggacccctt gcaccgaacc      1860
     attgagactt ttgccaagga ggaaccaaag gaagacattg atgtctccat tctgccccag      1920
     ctggagcact gcagctccaa gaagatgaat acatggctcg gcattttcta tggttacaaa      1980
     gggctgctgc tgctgctggg aatctttctt gcttatgaga ccaaaagtgt gtccactgaa      2040
     aagatcaatg accacagggc cgtgggcatg gctatctaca atgttccggt cctgtgtctc      2100
     attaccgctc ctgtcaccat gatcctttcc agccagcagg acgcagcctt cgcctttgcc      2160
     tctctggcca ttgtgttctc ttcctacatt actctggttg tgctctttgt gcctaagatg      2220
     cgcaggttga tcactcgagg tgaatggcag tctgaagcac aggacacaat gaaaacagga      2280
     tcatccacca acaacaatga ggaagagaag tcccgactgt tggagaagga aaaccgtgaa      2340
     ttggaaaaga tcatcgccga gaaagaggag cgtgtctctg aactgcgcca tcagctccag      2400
     tctcggcagc agatccgctc ccggcgccac cccccaacac ccccagaccc ctctgggggc      2460
     cttcccaggg gaccctcaga gccccctgac cggcttagct gtgatgggag tcgagtacat      2520
     ttgctttaca agtga                                                       2535
//