Dbfetch

ID   AH007710; SV 2; linear; genomic DNA; STD; HUM; 14128 BP.
XX
AC   AH007710; AF119822-AF119831;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens chromosome 12 adrenoleukodystrophy-related protein (ALD1)
DE   gene, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-14128
RX   DOI; 10.1006/bbrc.1999.0535.
RX   PUBMED; 10329405.
RA   Holzinger A., Mayerhofer P., Berger J., Lichtner P., Kammerer S.,
RA   Roscher A.A.;
RT   "Full length cDNA cloning, promoter sequence, and genomic organization of
RT   the human adrenoleukodystrophy related (ALDR) gene functionally redundant
RT   to the gene responsible for X-linked adrenoleukodystrophy";
RL   Biochem. Biophys. Res. Commun. 258(2):436-442(1999).
XX
RN   [2]
RP   1-14128
RA   Holzinger A., Mayerhofer P.U.;
RT   ;
RL   Submitted (13-JAN-1999) to the INSDC.
RL   Clinical Chemistry and Metabolism, Dr. von Hauner Children's Hospital,
RL   Lindwurmstrasse 4, Munich 80337, Germany
XX
DR   MD5; a2b63666d0b2fc14447e225cd8896382.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:4836428, gi:4836429, gi:4836430, gi:4836431, gi:4836432,
CC   gi:4836433, gi:4836434, gi:4836435, gi:4836436, gi:4836437,
CC   gi:4836438.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..14128
FT                   /organism="Homo sapiens"
FT                   /chromosome="12"
FT                   /map="12q11-q12"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..14128
FT                   /gene="ALD1"
FT                   /note="ALDR"
FT   regulatory      1..2381
FT                   /gene="ALD1"
FT                   /regulatory_class="promoter"
FT   mRNA            join(2382..3877,4939..5119,5749..5864,6803..6971,
FT                   7867..7961,8707..8852,9850..9995,11021..11105,12027..12152,
FT                   12720..14128)
FT                   /gene="ALD1"
FT                   /product="adrenoleukodystrophy-related protein"
FT   exon            2382..3877
FT                   /gene="ALD1"
FT                   /number=1
FT   5'UTR           2382..2938
FT                   /gene="ALD1"
FT   CDS             join(2939..3877,4939..5119,5749..5864,6803..6971,
FT                   7867..7961,8707..8852,9850..9995,11021..11105,12027..12152,
FT                   12720..12939)
FT                   /codon_start=1
FT                   /gene="ALD1"
FT                   /product="adrenoleukodystrophy-related protein"
FT                   /note="peroxisomal ABC transporter"
FT                   /protein_id="AAD30439.1"
FT                   /translation="MTHMLNAAADRVKWTRSSAAKRAACLVAAAYALKTLYPIIGKRLK
FT                   QSGHGKKKAAAYPAAENTEILHCTETICEKPSPGVNADFFKQLLELRKILFPKLVTTET
FT                   GWLCLHSVALISRTFLSIYVAGLDGKIVKSIVEKKPRTFIIKLIKWLMIAIPATFVNSA
FT                   IRYLECKLALAFRTRLVDHAYETYFTNQTYYKVINMDGRLANPDQSLTEDIMMFSQSVA
FT                   HLYSNLTKPILDVMLTSYTLIQTATSRGASPIGPTLLAGLVVYATAKVLKACSPKFGKL
FT                   VAEEAHRKGYLRYVHSRIIANVEEIAFYRGHKVEMKQLQKSYKALADQMNLILSKRLWY
FT                   IMIEQFLMKYVWSSSGLIMVAIPIITATGFADGEDGQKQVMVSERTEAFTTARNLLASG
FT                   ADAIERIMSSYKEVTELAGYTARVYNMFWVFDEVKRGIYKRTAVIQESESHSKNGAKVE
FT                   LPLSDTLAIKGKVIDVDHGIICENVPIITPAGEVVASRLNFKVEEGMHLLITGPNGCGK
FT                   SSLFRILSGLWPVYEGVLYKPPPQHMFYIPQRPYMSLGSLRDQVIYPDSVDDMHDKGYT
FT                   DQDLERILHNVHLYHIVQREGGWDAVMDWKDVLSGGEKQRMGMARMFYHKPKYALLDEC
FT                   TSAVSIDVEGKIFQAAKGAGISLLSITHRPSLWKYHTHLLQFDGEGGWRFEQLDTAIRL
FT                   TLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKTIKNEDETS"
FT   gap             4269..4368
FT                   /estimated_length=unknown
FT   exon            4939..5119
FT                   /gene="ALD1"
FT                   /number=2
FT   gap             5605..5704
FT                   /estimated_length=unknown
FT   exon            5749..5864
FT                   /gene="ALD1"
FT                   /number=3
FT   gap             6267..6366
FT                   /estimated_length=unknown
FT   exon            6803..6971
FT                   /gene="ALD1"
FT                   /number=4
FT   gap             7403..7502
FT                   /estimated_length=unknown
FT   exon            7867..7961
FT                   /gene="ALD1"
FT                   /number=5
FT   gap             8180..8279
FT                   /estimated_length=unknown
FT   exon            8707..8852
FT                   /gene="ALD1"
FT                   /number=6
FT   gap             9361..9460
FT                   /estimated_length=unknown
FT   exon            9850..9995
FT                   /gene="ALD1"
FT                   /number=7
FT   gap             10345..10444
FT                   /estimated_length=unknown
FT   exon            11021..11105
FT                   /gene="ALD1"
FT                   /number=8
FT   gap             11363..11462
FT                   /estimated_length=unknown
FT   exon            12027..12152
FT                   /gene="ALD1"
FT                   /number=9
FT   gap             12364..12463
FT                   /estimated_length=unknown
FT   exon            12720..14128
FT                   /gene="ALD1"
FT                   /number=10
FT   3'UTR           12937..14128
FT                   /gene="ALD1"
XX
SQ   Sequence 14128 BP; 4282 A; 2247 C; 2342 G; 4335 T; 922 other;
     ctgctgtctg catccttctg tgtaccatgt tctgcctaac aacatcctgc catcaccccc        60
     agttaggttt actctggcct ttaacctgtc ctgtcactgc taaccctttt gtgtgtaact       120
     gttaggagat gtgacataaa tgaaaggcaa ccttatcttg catacaacaa aagcaagagc       180
     ttaggaataa aagattttgg caataacttc catgaccact attatctgta catacaggct       240
     taaaaagtct taatgggatg atggattatg ctactaatat ggccagctat caaaaaaact       300
     tgcatgagtt tgacactcat gtgtcagtca gtctgctgaa ttgaatgcaa acaaatgaag       360
     agatatgtga tgattgtcag aattaatatg agtacataag aaagaagttt taaaatttta       420
     agaatatggt tacttatgaa agtgaggata gttctttgtg ataaactcag taatgaagat       480
     catttaatgc tgagatgggt tttatattct agcacagagg tttgcaaact tctataaagg       540
     gccaaatagt acatatttta gtctttgttg catccaccac tgtggcttga aagaagccat       600
     agacagagag taaatgaatg ggtgtgactg ttttccaata aaactttatt tataaacaca       660
     aaaatgagaa ttttatataa ttttcacagg acaaaatatt cttgttttga agtattttca       720
     accacattct tgttttgaag tattttcaac cactttaaaa atgtaaaaat cattcctagc       780
     ttaagggtca tataaaatta agtggcaggc tagatttggc ccaccagttg taatttgcca       840
     acttctgttc tagcttgatg catattttcc taagctttta attgactgga aatgtgtatg       900
     tatgttgggg gccagctgct ggtgaacaaa actggctgta gctactgagc atactcagtg       960
     tcacttagaa atccccagaa gtttcagaat atatatcact tttgtaagat ttcagtagat      1020
     accacaagca gaagagcaag cagaaaggga gatttccgag aattttaatg agatgggggg      1080
     cggggacagt gaagagcaaa aaaaatggtt tttccatatc caaaaatata ctcagccctg      1140
     acttaaaaaa tgctcttggc tgggcgtggt ggcccacgtc tataatccga gcactttggg      1200
     aggctaaggc aggtggatca cttgaggcca ggaggctgag accagcctgg caaacatggc      1260
     aaaacccatc tctactaaaa ctacagaaat tagccaagta tggtaggcgc accctcgtaa      1320
     tcccagctac tcgggctgct gaggcaccaa cctgggaggc agaggctgca gtgagctgag      1380
     atcgtgccac tgcactccag cctgggtgac agagagagac tctgtctcat aaaaaaaaaa      1440
     aaaaaaaaaa aaaaaaagct ttttacattt tcaaaaatat gcagaattgt ccttgactgt      1500
     tgaacaattt aaatcctcca ttatggatgt gaagaatttt aagactctta gtttttatca      1560
     aataaccaaa tggaaatagg aagtagccca gtagattatc tctacagcta aacaaaacaa      1620
     acaaagcaga aacctgcaaa agacaaagca ttcttgaaaa atgaagtaag gtcctagaga      1680
     agctatttcc accatccaac accagctgaa ttcccaaatg gttaaacttt cactataagt      1740
     gctaccccac tccaagtaaa aactacttaa cacatgggag tagtaaacat gaaacattgc      1800
     tctcatttat ttaatagtcg tcaccttgta aataaatatg agtacatcag atctccagtt      1860
     atggggctgg aagattttta gcataaggac aagtaggatg cagaggaaaa agggagaatg      1920
     actagaggca tagcaaataa ttattttctg taacacggaa gacttttatc ctatttattt      1980
     acaagggaaa ccctcggatt acaacttgtc tattaggttc tgagaccttt tgtgaaatca      2040
     gacccccaaa aaagccgggg ggatctgtga aaaacagatc caagtgtatt tgatatttgg      2100
     cattctccgg tgtccctccc acttgtcact ttcttttctg atccgtttca gattcattcc      2160
     atatcctttt catattcatt ttatgttgat cctcttgtcc ctcctccctc attttcgtgg      2220
     ttccttctcc ctcctcgtct cattaaaact cttgcaaatc tccctttctg cttgctcttc      2280
     tgtttgcggt agctgctgaa atcttaccga agtgatgtat attctgaaac ttcttggcgg      2340
     gtttctaaag tgacattgag catgctcagt agttaggccc ggttttgttc gcttggaaat      2400
     ctccctttct gcttgctctt ctgtttgcgg tatctacttg aaatcttacc gaagtgatgt      2460
     atattcttga aacttctgtg ggtttctaag tgacacttga gcatgctcca gtagctagag      2520
     ccggttttgt tcgccagcag atggcctgat tcgacctctc caaaaataga cattttaact      2580
     ctctgaactc ctgtttaagg aaggatgtaa ttcgctttgc tctctcctca ttttcaaggt      2640
     tcaaagggaa gctgcgagga ttccaaggtc ccaccgccct cacagccaat gaggggcctg      2700
     ggagggagga gcttggtgca gcttgagctt ctgagagaat cattcccggt agatgcagcg      2760
     gagtctgagc tctgctgcat ctgtcacagc agaacaaaat taaaaacaca acagtggaag      2820
     agaaacgctg cagactatgg gacgctgtag gactttctaa aacatttgct ggggatttct      2880
     gtgaagcatg atcttttaaa acgaattctt ttggaagccg gtttgggtaa ctgggaaaat      2940
     gacacatatg ctaaatgcag cagctgatcg agtgaaatgg accagatcga gtgctgctaa      3000
     gagggctgcc tgcctggtgg ctgcggcata tgctctgaaa accctctatc ccatcattgg      3060
     caagcgttta aagcaatctg gccacgggaa gaaaaaagca gcagcttacc ctgctgcaga      3120
     gaacacagaa atactgcatt gcaccgagac catttgtgaa aaaccttcgc ctggagtgaa      3180
     tgcagatttc ttcaaacagc tactagaact tcggaaaatt ttgtttccaa aacttgtgac      3240
     cactgaaaca gggtggctct gcctgcactc agtggctcta atctcaagaa cctttctttc      3300
     tatctatgtg gctggtctgg atggaaaaat cgtgaaaagc attgtggaaa agaagcctcg      3360
     gactttcatc atcaaattaa tcaagtggct tatgattgcc atccctgcta ccttcgtcaa      3420
     cagtgcaata aggtacctgg aatgcaaatt ggctttggcc ttcagaactc gcctagtaga      3480
     ccacgcctat gaaacctatt ttacaaatca gacttattat aaagtgatca atatggatgg      3540
     gaggctggca aaccctgacc aatctcttac ggaggatatt atgatgttct cccaatctgt      3600
     ggctcacttg tattccaatc tgaccaaacc tattttagat gtaatgctga cctcctatac      3660
     actcattcaa actgctacat ccagaggagc aagcccaatt gggcccaccc tactagcagg      3720
     acttgtggtg tatgccactg ctaaagtgtt aaaagcctgt tctcccaaat ttggcaaact      3780
     ggtggcagag gaagcacata gaaaaggcta tttgcggtat gtgcactcga gaattatagc      3840
     caatgtagaa gaaattgcct tttacagagg acataaggta agatagaaat taaggtgatg      3900
     ggtgaaatgt gaaactgttc aagttgccac tgcagtgcca gataccatct gttgtcctgt      3960
     cgatggaccc acttctttag tgtcttagat tcctctgaca tctaaacctg aattaaaata      4020
     tatgcttcat tacccctttt aactgtaacc agttaaagaa ttatagggtg caaacttttc      4080
     taaagtttca gaagaataaa atttgcaaca ctctaaaaaa gtctacttag cctcagttac      4140
     tcaaatatgc tcagaattat ttctaacgca ttttcttaaa acttaaatcc caacttggta      4200
     ggtcatccta aagcacctac cagaagaaaa tatatattta gaaactaaga ctaaacatat      4260
     ttcccctgnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnngt tttacagcag      4380
     tagcaacctg aaaaataata tttaaagaaa tttaggaatc ctactcccac tggaaaatgg      4440
     acctcatata tggtattata tcatatgatt tgtgttcttc ttgaactatg gaattcaatg      4500
     aaataaatta tagtgtgctt agacttcttg cataaaagac aaaatccaac aaatggagtc      4560
     agttcaaaag gggagtaaaa acaaaaaaat gtcatgggtc cattttcaga tattttgggg      4620
     gtaatcaaca aggacaaagc tttaataatt ggttattcat gtctcaaata atatcattta      4680
     attttaaaat ctcaaacata aaatttaaat atcataacca taaattaatt aaatgtattt      4740
     taaacctaac attatgtcca ctgagtagca taaaatttta aaaataataa aaatgggacc      4800
     aaaactaaat aataactaat actggtatta atttgcattt attggttaag atgcatagat      4860
     aatgccatac taaaaaaaaa aaagaataac atgcatatat ctttaaaaaa agtccccaac      4920
     tctttttcct cgttataggt agaaatgaaa caacttcaga aaagttacaa agctttagca      4980
     gatcagatga acctcatttt atccaaacgt ttgtggtaca tcatgataga acagttcctg      5040
     atgaagtatg tttggagcag cagtggacta attatggtgg ctatacctat tatcactgca      5100
     actggctttg cagatggtgg taatgacatt tatgcttaat ctcaaatata tttttaacat      5160
     tatttctttt gaagttgtca ttgctagttt tatgtgagct aaactgtgta catggtcata      5220
     ttctagttaa caatggtccg aaacaatggc agactttaca gcgtccagtg ataagaccag      5280
     cagtatgaaa taaggagaca gtggttcaaa gacgttccca gttctgagct atttcagaga      5340
     tctctgatgc agtgtttctc ggagttgacc ttgagcaatt ttaattatat tgcctaatat      5400
     aggatgattc tttagtttac acttaacctc agaataagtt agtaccctca gaaagagtat      5460
     aacacaagca ttcctcatgt gttataaaca ttagttctat acatcccata catttagtct      5520
     ataaatattc tataactgaa tttgccctgc tttgcgattt gaaaagtcca ttgactacaa      5580
     tgggcaagca ggaatattgc ttcannnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5640
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5700
     nnnnaaaaaa aaaaaaactc aagttttgta atttgttttt atatctagag gatggccaaa      5760
     agcaagttat ggttagtgaa cggacagaag cctttaccac tgctcgaaat ttactggcct      5820
     ctggagctga tgctattgaa aggattatgt cttcatacaa agaggtactt gcatttctta      5880
     ttgtcaattc aattaaaata aaatttatga aaatcaagca aaatgtcaat taccaagtat      5940
     acttagtatt ttggaaacat atcttttctc tgccaaaaat tgctgcgtat aatcaagatt      6000
     aagggcagca attcacaagt gtaatgctgc taatatcctt tgttttataa tactatcaat      6060
     tgttatctct ctttttccct ctatagtatg atatctttgt tttcacattt taaagaaacc      6120
     cttaggtatg aactctggag ccagagtgcc taaattttca ttttatgaat ttacaaatta      6180
     tgtgaccttg ggtcaaggtc gctacagcgt ctgtgtctct gtttcttcat ctataaaatg      6240
     gggatatgat aacctgactt gtggggnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6360
     nnnnnntcat ttcataatag gacaaaaagg aacttttctc ctacttaaaa tcttctattt      6420
     taaatagaaa aaggcaccaa aaataaaaga ttataatttc attgaatgac cttaagcttt      6480
     ccacaaaatt tataatttat tggaaatgaa tttcatcatg taaacagagg tcaaatcaga      6540
     aatttgactg aaagatcctt aagtgtcatt aatattctga aatctgtata ttatgtttta      6600
     taatttcaat caaacatatt attgtgttat agtgctcttt tgtactgtca tgtgttttag      6660
     ttttcagatg tattatatat atctcatgta taatgcaata tgatctttta cattaagtca      6720
     agaagcttat ctgattacat atttatttaa aatattgtct tggatatagt aactctattt      6780
     tatatctctg tgttgctttt aggtcactga attagcaggc tacactgctc gagtgtacaa      6840
     tatgttttgg gtctttgatg aagtaaaaag aggcatttat aagagaactg ctgtcattca      6900
     agaatctgaa agccatagca agaatggagc taaggtagaa ttacctctca gtgacacatt      6960
     ggcaattaaa ggtattaaac tcaagtgctt ttatattttc ctatatttaa gtatttatca      7020
     acagaaccaa agtttaagaa ggtagctttt agtagttaca aagtaccaac atttaaataa      7080
     ccaacattat ttaaacagca atccctaata ttagtattgc aatttgaggg gtggtgacta      7140
     acattaccac aaaaacacag tgttatgcta cttttattta ggacacaatt ttccaaatta      7200
     tttttggaaa ctgcacatat ggcataatga atcgtttgct tttaaaattc atctaacaaa      7260
     tagaattcga gctaatgtca tgttgttctt cattatactg tttctaaact taaatttggt      7320
     tacatatttt ttaaaattgc attattctat gtcttatttc ccttttttgc agcactgtgg      7380
     ttttttttct gtaggaattt tannnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7500
     nnttttttgc agcactgtgg ttttttttct gtaggatatg ttaatttagg gaaatagagt      7560
     agtagtaaaa attaaggctg ggttatttca gattgtatag ctttgctatt gtaatgatgt      7620
     tgtcattcaa ttattataaa atgtttctca gaaagatttt tcaagtagat gtgtcaatat      7680
     gtacaaattt gcattacatt aaactttgct tcaggtctgg atatctatat ttacatttgt      7740
     ttctgtgatt tattactgtg aattatcttt ataattgaaa ttacctgtta tactgcataa      7800
     taatttaagt tatttaatca gaatcctgtg ataatgtttg tatcttactc tttttcttaa      7860
     ttacaggaaa agttattgat gtggatcacg gaattatttg tgaaaatgtt cccataatta      7920
     caccagcagg agaagtggtg gcttccaggc taaacttcaa agtaagatga tattcaagaa      7980
     tcttctgatt gttgccatca cactaataca aaacaactca gaattcatgt accttatgtt      8040
     aaatacttgg aggagcattt ggaaagggga aatcaagaaa ggtatgcaca gtggctcaat      8100
     tacagaagca gttattcctc agaaagcaga gagaaaagag aaatttgatt tctactgctt      8160
     cattgccagg ttgaaaatcn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      8220
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnt      8280
     tggtagctat taattgcagt taantttcag gtgtatttga antcaatgta aatttaatcc      8340
     aatattaata tcaaaatcta atgtnatata nttttngtta aaattttctg atttgtctta      8400
     tttcccaggc agctgttttt ctctatgtgt atgtggtatc tgataacaaa ttacaatttt      8460
     ggaaagccag tgcccatttc aagaagatcc attttctttg gaattgaatt attttatgat      8520
     gnttttagnt tcagagaata gtcaaaagcc aaanttgttn tcaaccctga aatatttttc      8580
     cttgatcttt tgcccaacct aggttatcat gttttcgaac attttaaaaa aataatttac      8640
     ttttaggtgn tgccaaaata aatcatttta aantattgca gtttgtaatt ttatttctta      8700
     ctttaggtag aagaaggaat gcatcttttg ataactggtc ccaatggttg tgggaaaagt      8760
     tctctcttca gaattctaag tgggctctgg cctgtgtatg aaggagtcct ctataaacca      8820
     cctcctcaac atatgtttta tattccacaa aggtaggtat atctttttat attacaagaa      8880
     acaatttcct tttgctcttg aattgtcttg attcctcaag ttcctcagtt tatatatctt      8940
     taagaatgtt tttattaaga gaaactatta aggaaataaa aattcactta gcccaaaata      9000
     ttttattact gctttgattg taatactctg taggacaata ccactttttt tcattttcac      9060
     atctgtctag atggaataaa tactcaaaga ctgcagatgt tagtctcaag gaataacaag      9120
     caggctgttt cagagaatga ttagattgcc tgagatgtca gattatttct tctcacagaa      9180
     aaataataac acccggntaa gtatacagct ctctccatca agctgcatac attcatatat      9240
     tctaaaattg ttcatttata tttgaggatc cataaaatag actttacaat tatgctatat      9300
     gattatttag cgatttgtaa ctttcttaag gtaaattttt ttactgtaag aatgagtatc      9360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn tatggctcac aactgtaatc      9480
     ccagtgcttt gggaggccaa gttaggagga ancacttgag gcaggtgttt gagactagcn      9540
     ctgggaaaac atatcaagac cctgtctcta caaaatataa aataaaatag aattttttag      9600
     aaaaagaaaa tgtcagatga tttcttggag aagcttttct tgtgtccatg tgtcngtaag      9660
     tttttatgta aacataacgg tattgtttag cagtgcctga gggagaagta ctcatcgcca      9720
     ggtaacaaat atcatcctgg aaatgtagtg tttaaagtct tcactgatgt tttcagacta      9780
     ccaagttgtc acactgagta agttatcatg actttccact aggattcttg tgtgcttggt      9840
     gttttaaagg ccatatatgt ctcttggaag tcttcgggat caagtcattt accctgattc      9900
     agtggatgat atgcatgata aaggttatac agaccaagat ctggaacgta tcctacacaa      9960
     tgtccatctc tatcacatag ttcaaagaga aggaggtaaa gtctatcatt cttttctaat     10020
     gcatttaact tcacttttaa aaagtaagct tgggtatata tttagtctgt ggtttaattt     10080
     gaatgtatgc tataatcgga aataagcacg taagtgtaaa gatggagttt tattgctgtt     10140
     ccattattta catttctttt tctgcttgtg ttgtgtttaa tgcaacacac taagttttta     10200
     ttaagtctcc atgtcagtgc agctaacatt taaaaacagt ttttttcttt tatattcgaa     10260
     tgtacaaagt ccctgaggcc attgtcagtc tagatgtatg taaagtctat gacagacata     10320
     tttgccttac aagctctcag ctcannnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     10380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     10440
     nnnnttagct ccgaaccctt agggagggtt tgaaacccag gaccatgtgt aaaccctagg     10500
     acatgtcgat tactcccatg aactacagtt gcttcactta taaaatgcaa gaaataaaat     10560
     ctgtctttac aaaactgtga aatatatgat aagagaactc acataaagtg ctaggcacag     10620
     gagagccacc taaattagtt cctttcttac cctttgtaga ctttgtaatt gacatatgaa     10680
     aatttgttgg gtcttttctc ccatctccct ccaagataag tataagccta tcaacccacc     10740
     ggagacactg agaaacaaac acagttttta aagtgtcagg gtttagaatt cttgtaagat     10800
     catttgtcag tataagaagt tattaccatc agaagaatat caaatctaaa acaaaatgct     10860
     tatacatgag gctctgtagt ttatccaagc atatatccta taaaatacca agttcttcat     10920
     gttgacaatt tgaatttgtc aggaatcact tgtctagggt agaaatagta acaattaaac     10980
     aaatgattta taaaaatgta tattttttta ttttcttaag gatgggatgc tgttatggac     11040
     tggaaagatg tcctgtcagg aggggaaaag caaagaatgg gcatggctcg tatgttttat     11100
     cataagtaag tatactaaat tcaggtaact actaggccat tgttgtaacc aaaccaagca     11160
     acaataggaa caacaaaagt ttggacagga tttatcgtct tcatctgtag cttaaaaata     11220
     tcttactaca anattagtgc atagagttca cagttggttt ttttgtttgt ttgtttttga     11280
     gacagagtct cgctctgtca gccaggctgg agtgcagtgg cacgatcttg gctcactgca     11340
     acctccgtct cccaagggcc aannnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     11400
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     11460
     nngggagtat gggtccccaa tatttattga ggttaaatgt gtgttataaa tttgtaagnt     11520
     gagccacatt cactctcgca gtcttatagt gatgaaattc cattagtaat gcttaggtat     11580
     tcatattgct gataaaataa tcttctcatt aaatctttgc taacagggct gtggcctgtt     11640
     tgataattag ctactgcaat gtatttttca tgtagttagt cagacccttc tcaccaacaa     11700
     tgaacctgct ttctgcagga aaatgtactc agtgacctgc ctcatctttc ctatgtccca     11760
     tatttatgat tcattcatct acaagacaat aaagcttatt gtattattag aaagcgtcag     11820
     aaaatctatt taaatgtatt aaaaatgtga tattatagtc caaagaaggg gacaactact     11880
     tttttgcttt atcatttatt gcctttaata atgccatagt cttttttgct ccattaaaat     11940
     tgttagcaat gcaactcata ttgnccaaag aaaaacttat ggttcatata gcaaantaat     12000
     taatttttgt gtgtactttt taaaagacca aaatatgcct tgctggatga atgtaccagt     12060
     gctgtcagca ttgatgtcga aggaaagata tttcaggctg caaaaggggc tggaatttcc     12120
     ttactgtcta taacacacag accttctctt tggtaagtgt ttctagtgct aatttgtggt     12180
     agatggtttt tccttaaatt tctcaaaaaa taactttgct aaatttttca cagtagaggg     12240
     tagggtattt cacttatttc tacccatatt tctcttaagt tgcacattag tagcttagat     12300
     actccctacc taatatcatt agtgtattat ctgaattatc atcagtttcc agtaattctt     12360
     aaannnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     12420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnncagcatg tcttnattta     12480
     cagttaatat gcatccagaa tatgaaggga ataataatat tttcctaaag atcagattaa     12540
     tgacttttgg gttttaaaaa aatcccagta tttaactttt tgatatgtcc ttaaaactcn     12600
     aatgtaaaat agcacctact taaaatttgc ctttgggtat caatttgaat gataaaccta     12660
     caactaaaat gatttttcaa cattatggct aataatgtta tttcatttta attatgcagg     12720
     aaataccaca cacatttatt acagtttgat ggtgaaggag gttggcgctt tgaacaattg     12780
     gatactgcta tccgtttgac attgagtgaa gaaaaacaaa agctagaatc tcagctagct     12840
     ggaattccca aaatgcagca gagactcaat gaactatgta aaattttggg agaagactca     12900
     gtgctgaaaa caattaaaaa tgaagatgag acatcttaat ttgttttgac atattttaaa     12960
     aagttaatta ttagataaag gctcaaagac attctgttat actgcatgaa gtatgttaag     13020
     ctaagcacag agaaaaaaag gcagcaagac atgttttata agattttagc attaaggaag     13080
     tatatgatct gacttttcag aagaaaataa acaaatgcat tatgtaaggt cagtcattat     13140
     gacttatact aattcctagt gaaggcctaa tgcacttgta aaacaggatt ttctaggtga     13200
     attcctgatg aataccagat ttactatgta tatgtggtgt gtctgaagtt cttaacaaac     13260
     atgggcaata ttctggaaat gaaacaagtt ataactgagc accatttggg ttgataccaa     13320
     gtgcataaga ttcaaacttt gagtgacatt tagtccattt atggttgata ttaggtttaa     13380
     tacctagaat tcaaattgat tattgctagt ggccaactaa acctgtacaa aatagctgac     13440
     agttttataa ctaatttcaa tataaaaatt gttttaatgg catttgttga aagaaaaaag     13500
     catggctaaa atgtatcaaa tgccntattt ttaaattttg gactttaagc atcttaatga     13560
     gggcatataa caaattaatt ttagtacaat cttaaatatt tttaataaat cctttcattt     13620
     taaaaagaga attgccaata cagaaaagga gtatccaaac aatgtctcaa cctgataatt     13680
     tccttagcag aattacctat tgcaacttct gttcagaaat acacagcttg tttttttgcc     13740
     caaggatgag tctacatttt aagaactgca atggtataaa ggaacttaag gattctgaga     13800
     atcatagtaa taacatacat tggaatagta ctttataatt tacaatcccc atttacatca     13860
     tttcacctta atgttgagga caatgttttg aaacaaatac tatttttcct actttgcttt     13920
     tgagaaaatt gacactcaga cttgccctaa tcatgcactt tacttaagga aagatcgaga     13980
     aatcaaatga agttctcctg actctctggt ttagtgctct tttgttatta tcctttaaat     14040
     caaactgggc tataatagca ataaaagtta gacgaagtgt agaaaataaa ataaatttca     14100
     taatgttaaa aaaaaaaaaa aaaaaaaa                                        14128
//