spacer

EBI Dbfetch

ID   AF118044; SV 1; linear; mRNA; STD; MUS; 5858 BP.
XX
AC   AF118044;
XX
DT   07-SEP-1999 (Rel. 61, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus voltage-gated sodium channel NaN (Scn11a) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5858
RX   DOI; 10.1006/geno.1999.5890.
RX   PUBMED; 10444332.
RA   Dib-Hajj S.D., Tyrrell L., Escayg A., Wood P.M., Meisler M.H., Waxman S.G.;
RT   "Coding sequence, genomic organization, and conserved chromosomal
RT   localization of the mouse gene Scn11a encoding the sodium channel NaN";
RL   Genomics 59(3):309-318(1999).
XX
RN   [2]
RP   1-5858
RA   Dib-Hajj S.D., Tyrrell L., Waxman S.G.;
RT   ;
RL   Submitted (05-JAN-1999) to the INSDC.
RL   Neuroscience Research Center, 127A, Yale University/VAMC, 950 Campbell Ave,
RL   West Haven, CT 06516, USA
XX
DR   MD5; e5dce77322a6160e61959795f1c99f7b.
DR   Ensembl-Gn; ENSMUSG00000034115; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070617; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5858
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /strain="1CR"
FT                   /mol_type="mRNA"
FT                   /note="distal segment; close proximity to Scn5a and Scn10a"
FT                   /db_xref="taxon:10090"
FT   CDS             53..5350
FT                   /codon_start=1
FT                   /gene="Scn11a"
FT                   /product="voltage-gated sodium channel NaN"
FT                   /note="TTX-R sodium channel"
FT                   /db_xref="GOA:Q9R053"
FT                   /db_xref="InterPro:IPR001696"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR010526"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028821"
FT                   /db_xref="MGI:MGI:1345149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R053"
FT                   /protein_id="AAD53403.1"
FT                   /translation="MEERYYPVIFPDERNFRPFTFDSLAAIEKRITIQKEKKKSKDKAA
FT                   TEPQPRPQLDLKASRKLPKLYGDVPPDLIAKPLEDLDPFYKDHKTFMVLNKKRTIYRFS
FT                   AKRALFILGPFNPIRSFMIRISVHSVFSMFIICTVIINCMFMANNSSVDSRPSSNIPEY
FT                   VFIGIYVLEAVIKILARGFIVDEFSYLRDPWNWLDFIVIGTAIAPCFLGNKVNNLSTLR
FT                   TFRVLRALKAISVISGLKVIVGALLRSVKKLVDVMVLTLFCLSIFALVGQQLFMGILSQ
FT                   KCIKDDCGPNAFSNKDCFVKENDSEDFIMCGNWLGRRSCPDGSTCNKTTFNPDYNYTNF
FT                   DSFGWSFLAMFRVMTQDSWEKLYRQILRTSGIYFVFFFVVVIFLGSFYLLNLTLAVVTM
FT                   AYEEQNRNVAAETEAKEKMFQEAQQLLREEKEALVAMGIDRTSLNSLQASSFSPKKRKF
FT                   FGSKTRKSFFMRGSKTARASASDSEDDASKNPQLLEQTKRLSQNLPVELFDEHVDPLHR
FT                   QRALSAVSILTITMQEQEKSQEPCFPCGKNLASKYLVWECSPPWLCIKKVLQTIMTDPF
FT                   TELAITICIIVNTVFLAMEHHNMDNSLKDILKIGNWVFTGIFIAEMCLKIIALDPYHYF
FT                   RHGWNIFDSIVALVSLADVLFHKLSKNLSFLASLRVLRVFKLAKSWPTLNTLIKIIGHS
FT                   VGALGNLTVVLTIVVFIFSVVGMRLFGAKFNKTCSTSPESLRRWHMGDFYHSFLVVFRI
FT                   LCGEWIENMWECMQEMEGSPLCVIVFVLIMVVGKLVVLNLFIALLLNSFSNEEKDGNPE
FT                   GETRKTKVQLALDRFSRAFYFMARALQNFCCKRCRRQNSPKPNEATESFAGESRDTATL
FT                   DTRSWKEYDSEMTLYTGQAGAPLAPLAKEEDDMECCGECDASPTSQPSEEAQACDLPLK
FT                   TKRLPSPDDHGVEMEVFSEEDPNLTIQSARKKSDAASMLSECSTIDLNDIFRNLQKTVS
FT                   PQKQPDRCFPKGLSCIFLCCKTIKKKSPWVLWWNLRKTCYQIVKHSWFESFIIFVILLS
FT                   SGALIFEDVNLPSRPQVEKLLKCTDNIFTFIFLLEMILKWVAFGFRKYFTSAWCWLDFL
FT                   IVVVSVLSLTNLPNLKSFRNLRALRPLRALSQFEGMKVVVNALMSAIPAILNVLLVCLI
FT                   FWLIFCILGVNFFSGKFGRCINGTDINKYFNASNVPNQSQCLVSNYTWKVPNVNFDNVG
FT                   NAYLALLQVATYKGWLDIMNAAVDSRGKDEQPAFEANLYAYLYFVVFIIFGSFFTLNLF
FT                   IGVIIDNFNQQQKKLGGQDIFMTEEQKKYYNAMKKLGTKKPQKPIPRPLNKCQAFVFDL
FT                   VTSQVFDVIILGLIVTNMIIMMAESEGQPNEVKKIFDILNIVFVVIFTVECLIKVFALR
FT                   QHYFTNGWNLFDCVVVVLSIISTLVSGLENSNVFPPTLFRIVRLARIGRILRLVRAARG
FT                   IRTLLFALMMSLPSLFNIGLLLFLVMFIYAIFGMNWFSKVKRGSGIDDIFNFDTFSGSM
FT                   LCLFQITTSAGWDALLNPMLESKASCNSSSQESCQQPQIAIVYFVSYIIISFLIVVNMY
FT                   IAVILENFNTATEESEDPLGEDDFEIFYEIWEKFDPEATQFIQYSSLSDFADALPEPLR
FT                   VAKPNRFQFLMMDLPMVMGDRLHCMDVLFAFTTRVLGNSSGLDTMKAMMEEKFMEANPF
FT                   KKLYEPIVTTTKRKEEEECAAVIQRAYRRHMEKMIKLKLKGRSSSSLQVFCNGDLSSLD
FT                   VPKIKVHCD"
FT   polyA_signal    5823..5828
FT                   /gene="Scn11a"
XX
SQ   Sequence 5858 BP; 1509 A; 1436 C; 1372 G; 1541 T; 0 other;
     tggtgccctg agcctcccta gcaggaagac agtgtctgag ccaagggtga agatggagga        60
     gaggtactat ccagtgatct tcccagacga gaggaatttc cgccccttca ctttcgactc       120
     tttggctgca atagagaagc ggatcaccat ccaaaaggag aagaagaaat ccaaagacaa       180
     ggcagcaact gagccccagc ctcggcctca gctcgaccta aaggcctcca ggaagttacc       240
     taagctctat ggcgacgttc cccctgacct tatagcgaag cccctggaag atctggaccc       300
     attttacaaa gaccataaga cattcatggt attgaacaag aagagaacaa tctatcgctt       360
     cagcgccaag agggccttgt tcattctggg gccttttaat cccatcagaa gcttcatgat       420
     tcgcatctct gtccattcag tcttcagcat gttcattatc tgcacagtga tcatcaactg       480
     tatgttcatg gctaataatt cttctgtgga cagtcgtcct agcagtaaca ttcccgaata       540
     cgtcttcatt gggatttatg ttttagaagc tgtgattaaa atattggcaa gaggcttcat       600
     tgtggatgag ttttcctacc tccgagatcc ttggaactgg ctggacttca ttgtcatcgg       660
     aacagcgata gcgccttgtt ttctcggtaa caaagtcaat aatctttcca ctctacgtac       720
     cttccgagtg ttgagagctc tgaaagccat ttctgtaatc tcaggtctga aggtcatcgt       780
     gggtgccctg ctgcgctccg tgaagaagct agtggacgtg atggtcctca ctctcttttg       840
     cctcagcatc tttgccctgg ttggtcagca gctcttcatg ggaattctga gccagaaatg       900
     tattaaggac gactgtggcc ctaacgcttt ttccaacaag gattgctttg taaaagaaaa       960
     tgatagcgag gacttcataa tgtgtggcaa ctggctcggc agaagatcct gccccgatgg      1020
     ttccacgtgc aataaaacca catttaaccc agattataat tatacaaact ttgacagctt      1080
     tggctggtct tttctcgcca tgttccgggt tatgactcaa gactcctggg agaagcttta      1140
     tcgacagatc cttcgcacct ccgggatcta ctttgtcttc ttcttcgtgg tcgtcatctt      1200
     cctgggctct ttctacctgc ttaacttaac cctggctgtc gtcaccatgg cttacgagga      1260
     acagaacaga aatgtcgctg ccgagacaga ggccaaggag aagatgtttc aggaagccca      1320
     gcagctgttg agggaggaaa aggaggctct ggttgccatg ggaattgaca gaacttccct      1380
     taattccctc caagcttcgt ccttttcccc aaagaagagg aagttttttg gcagtaagac      1440
     aagaaagtcc ttctttatga gagggtccaa gacagcccga gcctcagcgt ccgattcaga      1500
     ggacgatgcc tctaaaaacc cacaactcct tgagcaaaca aaacgactat cccagaactt      1560
     gcccgtagaa ctctttgatg agcacgtgga ccccctccat aggcagagag cgctgagtgc      1620
     cgtcagtatc ttaaccatca ccatgcagga acaagaaaaa tcccaggagc cttgtttccc      1680
     gtgtgggaaa aacttggcat ccaagtacct ggtgtgggaa tgtagccctc cgtggctgtg      1740
     cataaagaag gtcctgcaga ctatcatgac agaccccttc actgagctgg ccatcaccat      1800
     ctgcatcatc gtcaatactg tcttcttggc catggaacac cacaatatgg ataactcttt      1860
     aaaagacata ctgaaaatag gaaactgggt tttcactgga attttcatag cggaaatgtg      1920
     tctcaagatc attgcgctag acccttacca ctacttccgg cacggctgga acatctttga      1980
     cagcattgtg gcccttgtga gtctcgctga cgtgctcttc cacaaactgt ctaaaaacct      2040
     ctccttcttg gcttccctca gagtgctgag ggtcttcaag ttagccaaat cctggcccac      2100
     attaaacact ctcattaaga tcatcggcca ctccgtgggt gcgctcggaa acctgactgt      2160
     ggtcctaacg atcgtggtct tcatcttttc cgtggttggc atgcggctct ttggtgccaa      2220
     gtttaacaag acttgctcca cctctccgga gtccctccgg cgctggcaca tgggtgattt      2280
     ctaccattcc ttcctggtgg tgttccgcat cctctgtggg gagtggatcg agaacatgtg      2340
     ggaatgcatg caggagatgg aaggctcccc gctgtgtgtc atcgtctttg tgctgatcat      2400
     ggtggtcggg aagctcgtgg tgcttaacct cttcattgcc ttgctgctca attccttcag      2460
     caatgaggaa aaggatggga acccagaagg agagaccagg aaaaccaaag tgcagctagc      2520
     cctggatcgg ttcagccgag cgttctactt catggcgcgc gctcttcaga atttctgttg      2580
     caagagatgc aggaggcaaa actcgccaaa gccaaatgag gcaacagaaa gctttgctgg      2640
     tgagagtaga gacacagcca ccctggatac aaggtcctgg aaggagtatg attcagaaat      2700
     gactctgtac actgggcagg ccggggctcc actggcccca ctggcaaaag aagaggacga      2760
     tatggaatgt tgtggtgaat gtgatgcctc acctacctca cagcctagtg aggaagctca      2820
     ggcctgtgac ctccctctga agaccaagcg gctccccagc ccagatgacc acggggttga      2880
     aatggaagtg ttttccgaag aagatccgaa tttaaccata cagagtgctc gaaagaagtc      2940
     tgatgcggca agcatgctct cagaatgcag cacaatagac ctgaatgata tctttagaaa      3000
     tttacagaaa acagtttccc cccaaaagca accagatcga tgctttccca agggcctcag      3060
     ttgtatcttt ctatgttgca aaacaatcaa aaaaaagtcc ccctgggtcc tgtggtggaa      3120
     tcttcggaaa acctgctacc aaatcgtgaa gcatagctgg tttgagagct tcataatttt      3180
     tgtcatcctg ctgagcagcg gagcactgat attcgaagat gtcaatcttc ccagccggcc      3240
     ccaagttgaa aaattactga agtgtaccga taatattttc acatttattt ttctcctgga      3300
     aatgattttg aagtgggtgg cctttggatt ccggaagtat ttcaccagtg cctggtgctg      3360
     gctcgatttc ctcattgtgg tggtgtctgt gctcagcctc acgaacttac caaacttgaa      3420
     gtccttccgg aatctgcgag cgctgagacc tctgcgggca ctgtctcagt ttgaaggaat      3480
     gaaggttgtt gtcaatgccc tcatgagtgc catacctgcc atcctcaatg tcttgctggt      3540
     ctgcctcatt ttctggctca tattttgtat cctgggagta aatttttttt ctgggaagtt      3600
     tggaagatgc attaatggaa cagacataaa taaatatttc aacgcttcca atgttccaaa      3660
     ccaaagccaa tgtttagtta gtaattacac gtggaaagtc ccgaatgtca actttgacaa      3720
     cgtggggaat gcctaccttg ccctgctgca agtggcgacc tataagggct ggctggacat      3780
     tatgaatgca gctgttgatt ccagagggaa agatgagcag ccggcctttg aggcgaatct      3840
     atacgcatac ctttacttcg tggtttttat catcttcggc tcattcttta ccctgaacct      3900
     ctttatcggt gttattattg acaacttcaa tcagcagcag aaaaagttag gtggccaaga      3960
     catttttatg acagaagaac agaagaaata ttacaatgca atgaaaaagt taggaaccaa      4020
     gaagcctcaa aagcccatcc caaggcccct gaacaaatgt caagccttcg tgttcgattt      4080
     ggtcacaagc caggtctttg acgtcatcat tctgggtctt attgtcacaa acatgattat      4140
     catgatggct gaatctgaag gccagcccaa cgaagtgaag aaaatctttg atattctcaa      4200
     catagtcttc gtggtcatct ttaccgtaga gtgtctcatc aaagtctttg ctttgaggca      4260
     acactacttc accaatggct ggaacttatt tgattgtgtg gtcgtggttc tttccatcat      4320
     tagtaccttg gtttctggct tggagaacag caacgtcttc ccgcccacac tcttcaggat      4380
     tgtccgcttg gctcggatcg gtcgaatcct cagactggtc cgggcggctc gaggaatcag      4440
     gacactcctt ttcgcgttga tgatgtctct cccctctctc ttcaacattg gtctgcttct      4500
     ctttctggtg atgttcattt atgccatctt tgggatgaac tggttttcca aagtgaagag      4560
     aggctctggg attgatgaca tcttcaactt tgacactttc tcgggcagca tgctctgcct      4620
     cttccagata accacttcag ccggctggga tgctctcctc aaccccatgc tggaatcaaa      4680
     agcctcttgc aattcctcct cccaagagag ctgtcagcag ccgcagatag ccatagtcta      4740
     cttcgtcagc tacatcatca tctcctttct cattgtggtt aacatgtaca tagctgtgat      4800
     tctagagaac ttcaacacag ccacagagga gagcgaggac cccctgggcg aagacgactt      4860
     tgagatcttc tatgagatct gggagaagtt tgaccccgaa gcaacacagt tcatccagta      4920
     ctcatccctc tctgacttcg ccgacgccct gcccgagccg ttgcgtgtgg ccaagcccaa      4980
     caggtttcag tttctcatga tggacttgcc catggtgatg ggtgatcgcc tccattgcat      5040
     ggatgttctc tttgctttca ccaccagggt cctcgggaac tccagcggct tggataccat      5100
     gaaagccatg atggaggaga agttcatgga ggccaatcct ttcaagaagt tgtacgagcc      5160
     cattgtcacc accacaaaga ggaaggagga ggaggaatgt gccgctgtca tccagagggc      5220
     ctaccggaga cacatggaga agatgatcaa gctgaagctg aaaggcaggt caagttcatc      5280
     gctccaggtg ttttgcaatg gagacttgtc tagcttggat gtgcccaaga tcaaggttca      5340
     ttgtgactga aacccccacc tgcacgccta cctcacagcc tcacagctca gcccccagcc      5400
     tctggcgaac aagcggcgga ctcaccgaac aggccgttca acttgttttt ttgggtgaaa      5460
     gaggtgatag gttggtgtcc atttttaaat gattcttgga aagattgaac gtcggaacat      5520
     gttagaaagg actgccaagg acatccacag taacggaagg cctgaaggac agttcaaatt      5580
     atgtaaagaa acgagaagga aaggtcacat gtctgttcag ttttaagtat gtgacctgcc      5640
     acatgtagct cctttgcatg ttaagtgaga agtcaaaacc ctgccataag taaatagctt      5700
     tgttgcaggt gtttctacca gtgctgccga tttgggtgta tggctcaaac ctgaaagcat      5760
     gactctgact tgtcagcacc ccaactttca gaagctctga tctctgtcct aggtgtttga      5820
     caaataaata cataaaaaaa aaaaaaaaaa aaaaaaaa                              5858
//


spacer
spacer