Dbfetch

ID   AF117979; SV 1; linear; genomic DNA; STD; HUM; 4885 BP.
XX
AC   AF117979;
XX
DT   26-APR-1999 (Rel. 59, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Homo sapiens homeodomain transcription factor NBPHOX (PMX2B) gene, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4885
RX   DOI; 10.1089/104454900439773.
RX   PUBMED; 11034547.
RA   Adachi M., Browne D., Lewis E.J.;
RT   "Paired-like homeodomain proteins Phox2a/Arix and Phox2b/NBPhox have
RT   similar genetic organization and independently regulate dopamine
RT   beta-hydroxylase gene transcription";
RL   DNA Cell Biol. 19(9):539-554(2000).
XX
RN   [2]
RP   1-4885
RA   Lewis E.J., Browne D.;
RT   ;
RL   Submitted (05-JAN-1999) to the INSDC.
RL   Biochemistry and Molecular Biology, Oregon Health Sciences University,
RL   L224, Portland, OR 97201, USA
XX
DR   MD5; b81467cb264be93e7d0562e3f9c4d707.
DR   Ensembl-Gn; ENSG00000109132; homo_sapiens.
DR   Ensembl-Tr; ENST00000226382; homo_sapiens.
DR   EuropePMC; PMC1773584; 12631670.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4885
FT                   /organism="Homo sapiens"
FT                   /chromosome="4"
FT                   /map="4p12"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..600,1434..1621,2646..4885)
FT                   /gene="PMX2B"
FT                   /product="homeodomain transcription factor NBPHOX"
FT   5'UTR           1..359
FT                   /gene="PMX2B"
FT   CDS             join(360..600,1434..1621,2646..3161)
FT                   /codon_start=1
FT                   /gene="PMX2B"
FT                   /product="homeodomain transcription factor NBPHOX"
FT                   /db_xref="GOA:Q99453"
FT                   /db_xref="HGNC:HGNC:9143"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99453"
FT                   /protein_id="AAD26698.1"
FT                   /translation="MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYN
FT                   PIRTTFGATSGCPSLTPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTT
FT                   FTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAA
FT                   AAAAKNGSSGKKSDSSRDDESKEAKSTDPDSTGGPGPNPNPTPSCGANGGGGGGPSPAG
FT                   APGAAGPGGPGGEPGKGGAAAAAAAAAAAAAAAAAAAAGGLAAAGGPGQGWAPGPGPIT
FT                   SIPDSLGGPFGSVLSSLQRPNGAKAALVKSSMF"
FT   3'UTR           3162..4885
FT                   /gene="PMX2B"
FT   regulatory      4864..4870
FT                   /gene="PMX2B"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 4885 BP; 1111 A; 1286 C; 1253 G; 1233 T; 2 other;
     ttaaatttta attagagatg caggatcaat gatagggagt tggacagttc agttccccag        60
     tgccagccca atagacggat gagttatttt catgtaaaaa gcgccagcaa taagaccaac       120
     cgtttgttat tgtcccaagt ggaaagagcc aagtttatta tgaggactat atggttttag       180
     agacttcaga caaggcatnt cataggaggc tttttcataa aactaggntc tgctggtagt       240
     aaggaggcca gtttggaggc aggcgttgag ctgtgcacat ctccccactc cagccacctt       300
     ctccatatcc atcttttatt tcatttttcc acttggctga gccatccaga accttttcaa       360
     tgtataaaat ggaatattct tacctcaatt cctctgccta cgagtcctgt atggctggga       420
     tggacacctc gagcctggct tcagcctatg ctgacttcag ttcctgcagc caggccagtg       480
     gcttccagta taacccgata aggaccactt ttggggccac gtccggctgc ccttccctca       540
     cgccgggatc ctgcagcctg ggcaccctca gggaccacca gagcagtccg tacgccgcag       600
     gtaaggacct tcagctttct cagcggagga agccgccttt ccgcccgtat ataggaagcc       660
     ttgattgcat ttgaaaatgg aaatgtgttt agtatttacc aaacgaaatt tgcttacaca       720
     aatgaaagaa tttatcacgt tagaagcgat tgcagggagg ggtaattcac ttacagggtt       780
     acactatcct agtcacaccc gaaccgccaa caaaattatc ttaagctgcc aaaatgatag       840
     gcataattta tttactttgc gatgagacgt aaagcttaga aaataattaa ataacaaaga       900
     gtaaagctca ttactggcag tgtctctttt tttaagaacc gacagcggct cacacctctt       960
     tggctggtca tttttatgat tatttcttta atttattatt atttttttgc agctctttcc      1020
     cccaactttt gagccgggtc aactttctga gaattgaaaa gttcccaaag tgggactgtt      1080
     tggtaacttc tttcctggct ccctgatatt ccgactgatg tttttggatt tttttcctct      1140
     ctggtttttt cctgctgaaa gcactatctc aagtccgtca catcgcgctg tttcaatcca      1200
     cccaaaggcg cttgtgccag aaaggactcc gccaagcccg aagtttgagc ccaggtttcc      1260
     gcagataaca aatttcctcg gtttcttccc gcagcttctc tcggcaactc tctcgcgcgg      1320
     gtgtaggtag cggctgccgt atgacctgac cttggagtcc tcacattcta gctccacggc      1380
     cggcgagctg ccggctgatt tgctcacttt ctgtctcctc tgtcatactc tagttcctta      1440
     caaactcttc acggaccacg gcggcctcaa cgagaagcgc aagcagcggc gcatccgcac      1500
     cactttcacc agtgcccagc tcaaagagct ggaaagggtc ttcgcggaga ctcactaccc      1560
     cgacatctac actcgggagg agctggccct gaagatcgac ctcacagagg cgcgagtcca      1620
     ggtacgcgcg cctggaaacc gaccccgctc cgccgcactg gtccggggag gtgtggggtg      1680
     aggggcggct ggtaaattcg aagtcctgga gcctcgagtg agaaggacct agggccccat      1740
     ggccgatcag aaatactgga tttggtgtgg ctgtgcgttc gagagaggct tagagcgcac      1800
     gctcttggca ttttatttac agttgcgaag tgtttcccac ccgagcagag acatgggggg      1860
     ccttgggacg tggatgagcg atgcaatttc ggggacagga agtgcctgtg gtggaaggtg      1920
     tgcagacttt gctcccgtat tataagtttt tccttctccc ctcccgcccc ccaaaaaaat      1980
     gcctcctaac tcaagtgctt ttaacctggc cccatggcat ataggttcat tttcccggaa      2040
     actgtgactt gcatcagatt tgcaaagggt ctgtgacttc atgaaggtca agaaccatga      2100
     cttactccaa cctgttaaac acaggtgcgc tcacgagttg gccacagcgc ctctctgggt      2160
     gagcccccga ccgagaagcg gtgcgcacca tcgcacgctc ttccaggctc aaaggccggg      2220
     gatgggcagc ggagcaaacc cagaggatcc cttttccttc taccaattag agtttaactt      2280
     tagaacttag gcttaggggt gaatggcgag ctcggggctt gctcaagaag ccgacttgaa      2340
     cagaggccca ccaaaataag gccttccctt ttcgggtctt tctgggacct gcggcttttt      2400
     aaactctgcc gcaagccttc atgtccctgg cgtgctcact ccccctaaga aagtttctcc      2460
     gaaaatgcac agcaataaga agcggtagac ttggtggatg tgcgcgcggg ggtgatcaca      2520
     gcgcatgggg aggagggtgt taaaacaagc cgaagtagaa cttgggccac cctaaccggt      2580
     gcttttcttt cccattttct tctttctccc cctgcttcac cgtctctcct tccgtcttgg      2640
     gccaggtgtg gttccagaac cgccgcgcca agtttcgcaa gcaggagcgc gcagcggcag      2700
     ccgcagcggc cgcggccaag aacggctcct cgggcaaaaa gtctgactct tccagggacg      2760
     acgagagcaa agaggccaag agcactgacc cggacagcac tgggggccca ggtcccaatc      2820
     ccaaccccac ccccagctgc ggggcgaatg gaggcggcgg cggcgggccc agcccggctg      2880
     gagctccggg ggcggcgggg cccgggggcc cgggaggcga acccggcaag ggcggcgcag      2940
     cagcagcggc ggcggccgcg gcagcggcgg cggcggcagc ggcagcggcg gcagctggag      3000
     gcctggctgc ggctgggggc cctggacaag gctgggctcc cggccccggc cccatcacct      3060
     ccatcccgga ttcgcttggg ggtcccttcg gcagcgtcct atcttcgctc caaagaccca      3120
     acggtgccaa agccgcctta gtgaagagca gtatgttctg atctggaatc ctgcggcggc      3180
     ggcggcggcg gcgacagcgg gcgagccagg gcccgggcgg gcgagtgggc gagcgggtag      3240
     gcccaaggct attgtcgtcg ctgctgccat ggctttttca ttgagggcct aaagtaatcg      3300
     cgctaagaat aaagggaaaa cggcgtcgcc ctcatttcaa ccccactcct acccccttcc      3360
     tcaaccccca aacaaaacaa acaaacttcc ctggcttcgc acctgcctgg ggcctcgcag      3420
     cggggccagg gctccgcctg ctgatcgggg gttgtgagca gcgcggcctg gacgcggggc      3480
     actctcaggg ggctgtgtct gcgtgtcagt ttgtgtctgt ctcggggaat gtgtgtctgt      3540
     ggcccaagca ggtgacagga agagatgggg ggcctcaacc aacttagtga cttgtttaga      3600
     aaaaaaagac aaaaaagtaa aaataaaaac aaaaaagttg gaaggcagaa accattaaaa      3660
     aacaaaaagc caacaaccca gaaaggttta aaaaacataa ggaaaaaaaa gacaaattaa      3720
     aggaggggct aggggagaag ctgcagctgg agctgaaggc tcgatcttgt gaacccctaa      3780
     atccgctccc tcctaacagc acggattctc ttggggctct tcttcaggga agagtaggga      3840
     cgccgttcca gccccccttc ctatcgtgtc cttgggttcg ggtcactgcg gcgacgactt      3900
     gctcagactg tcccggcggc cggagtgact ttctcgcacc cccttgcctg tcccacctcg      3960
     ctgaacacca tcccgccatt agcgcatcgg aaccccacac agttgcaact cccaaccccg      4020
     aatctttgca gccgttcggc cctgaaagat gccctatcca tgagatgcct tttcatctgc      4080
     aaactctgca aaatgtgtct catgtttcgc aactcttttt ttccccctcg ctcccgccta      4140
     ccccgtcggc attttcttct tccaccagct tttactgaac tttttggcac tgctttggat      4200
     tggggtcaat tgcagtccac gtaactggct gcagagaaat ctaccgagca aggaaaaggc      4260
     acacacacac gtttgcaggg gtgtctcggt ttgcatttct gttggaatga tccgaactgg      4320
     actcacatcc tgtatggtgg atggactgta tattgagggt tccattcttc gcgcagttta      4380
     gacatctctg ttttgattct ttgttgttgt ttttatttta aaaggcacaa actctagata      4440
     ttagttgaat gttgaggctt taactttttc ggtgtctttc tacaactgtg ttctgtgact      4500
     caattgtatc gtgttaatat cagtgcagac tgtctcctct acgtgaccgt ataatgtttt      4560
     tctcgtcttg tagtctctat ggcgtgtctt tatggtgtaa taaggttctc acggggtcaa      4620
     tcttttgtgt ttagagaggc cacggttcag acaatggtat atatttttgt tatcaggtgc      4680
     atgtctgtct gatttctttt tttttcctgt tggactatgt ttgtgaacat aattgtcata      4740
     agttatgttt cagatttttg aatttattta tatgtgttat aatgaatgct tctatttaaa      4800
     agggaaatat ttctacatgt gcttatagtt ttccaagagt gtaccattaa cttgattgtt      4860
     gataataaaa accaaaagca agtct                                            4885
//