Dbfetch

ID   AF117821; SV 1; linear; mRNA; STD; MUS; 216 BP.
XX
AC   AF117821;
XX
DT   26-APR-1999 (Rel. 59, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus renin b mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-216
RX   PUBMED; 9933256.
RA   Lee-Kirsch M.A., Gaudet F., Cardoso M.C., Lindpaintner K.;
RT   "Distinct renin isoforms generated by tissue-specific transcription
RT   initiation and alternative splicing";
RL   Circ. Res. 84(2):240-246(1999).
XX
RN   [2]
RP   1-216
RA   Lee-Kirsch M., Gaudet F., Cardoso M.C., Lindpaintner K.;
RT   ;
RL   Submitted (05-JAN-1999) to the INSDC.
RL   Department of Medicine, Brigham and Women's Hospital, 75 Francis Street,
RL   Boston, MA 02115, USA
XX
DR   MD5; 250235a721b04bfebf372367ec350799.
DR   Ensembl-Gn; ENSMUSG00000070645; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016485; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016468; mus_musculus_aj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016428; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016254; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016889; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015834; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016228; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016333; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_LPJ_G0016404; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016357; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016925; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015620; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015896; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000112287; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0022138; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0022106; mus_musculus_aj.
DR   Ensembl-Tr; MGP_BALBcJ_T0022078; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0021884; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0022591; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0021414; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0021831; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0021956; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_LPJ_T0022058; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0021942; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0022625; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0021149; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0021461; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..216
FT                   /organism="Mus musculus"
FT                   /strain="C57BL"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             83..>216
FT                   /codon_start=1
FT                   /product="renin b"
FT                   /note="aspartyl-protease; brain-specific isoform; includes
FT                   exon 1b"
FT                   /db_xref="GOA:Q9R259"
FT                   /db_xref="MGI:MGI:97898"
FT                   /db_xref="UniProtKB/TrEMBL:Q9R259"
FT                   /protein_id="AAD26253.1"
FT                   /translation="MPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYL"
XX
SQ   Sequence 216 BP; 52 A; 58 C; 60 G; 46 T; 0 other;
     tccggctgct ttgaagattt gatgagagga tacgcatagc acttccgatg ccaggcgggg        60
     aacggtaatc ccgctcaaga aaatgccttc tgtccgggaa atcctggagg agcggggagt       120
     ggacatgacc aggctcagtg ctgaatgggg cgtattcaca aagaggcctt ccttgaccaa       180
     tcttacctcc cccgtggtcc tcaccaacta cctgaa                                 216
//