spacer

EBI Dbfetch

ID   AF117608; SV 1; linear; mRNA; STD; MUS; 2692 BP.
XX
AC   AF117608;
XX
DT   02-JAN-2000 (Rel. 62, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus fallotein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2692
RA   Tsai Y.-J., Lee R.K.-K., Chen Y.-H., Lin S.-P., Cheng W.T.-K.;
RT   "cDNA cloning of fallotein from mouse ovary";
RL   Unpublished.
XX
RN   [2]
RP   1-2692
RA   Tsai Y.-J., Lee R.K.-K., Chen Y.-H., Lin S.-P., Cheng W.T.-K.;
RT   ;
RL   Submitted (03-JAN-1999) to the INSDC.
RL   Medical Research, Mackay Memorial Hospital, 45 Min Sheng Road, Tamshui,
RL   Taipei 25115, Taiwan
XX
DR   MD5; 2a75e1f4e4dff23c0c31890088757e02.
DR   Ensembl-Gn; ENSMUSG00000028019; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029652; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2692
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /tissue_type="ovary"
FT                   /db_xref="taxon:10090"
FT   CDS             198..1235
FT                   /codon_start=1
FT                   /product="fallotein"
FT                   /note="putative secretory protein"
FT                   /db_xref="GOA:Q8CI19"
FT                   /db_xref="InterPro:IPR000072"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="InterPro:IPR029817"
FT                   /db_xref="MGI:MGI:1859631"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CI19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAF22516.1"
FT                   /translation="MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPR
FT                   HERVVTISGNGSIHSPKFPHTYPRNMVLVWRLVAVDENVRIQLTFDERFGLEDPEDDIC
FT                   KYDFVEVEEPSDGSVLGRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSII
FT                   MPQVTETTSPSVLPPSSLSLDLLNNAVTAFSTLEELIRYLEPDRWQVDLDSLYKPTWQL
FT                   LGKAFLYGKKSKVVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCG
FT                   GNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCR
FT                   GNAGG"
FT   regulatory      2662..2667
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 2692 BP; 754 A; 576 C; 617 G; 745 T; 0 other;
     caaaaactgg agacacagaa gagggctcta ggaaaaactt ttggatggga ttatgtggaa        60
     actaccctgc gattctctgc tgccagagcc ggccaggcgc ttccaccgca gcgcagcctt       120
     tccccggctg ggctgagcct tggagtcgtc gcttccccag tgcccgccgc gagtgagccc       180
     tcgccccagt cagccaaatg ctcctcctcg gcctcctcct gctgacatct gccctggccg       240
     gccaaagaac ggggactcgg gctgagtcca acctgagcag caagttgcag ctctccagcg       300
     acaaggaaca gaacggagtg caagatcccc ggcatgagag agttgtcact atatctggta       360
     atgggagcat ccacagcccg aagtttcctc atacgtaccc aagaaatatg gtgctggtgt       420
     ggagattagt tgcagtagat gaaaatgtgc ggatccagct gacatttgat gagagatttg       480
     ggctggaaga tccagaagac gatatatgca agtatgattt tgtagaagtt gaggagccca       540
     gtgatggaag cgttttagga cgctggtgtg gttctgggac tgtgccagga aagcagactt       600
     ctaaaggaaa tcatatcagg ataagatttg tatctgatga gtattttcca tctgaacccg       660
     gattctgcat ccactacagt attatcatgc cacaagtcac agaaaccacg agtccttcgg       720
     tgttgccccc ttcatctttg tcattggacc tgctcaacaa tgctgtgact gccttcagta       780
     ccttggaaga gctgattcgg tacctagagc cagatcgatg gcaggtggac ttggacagcc       840
     tctacaagcc aacatggcag cttttgggca aggctttcct gtatgggaaa aaaagcaaag       900
     tggtgaatct gaatctcctc aaggaagagg taaaactcta cagctgcaca ccccggaact       960
     tctcagtgtc catacgggaa gagctaaaga ggacagatac catattctgg ccaggttgtc      1020
     tcctggtcaa gcgctgtgga ggaaattgtg cctgttgtct ccataattgc aatgaatgtc      1080
     agtgtgtccc acgtaaagtt acaaaaaagt accatgaggt ccttcagttg agaccaaaaa      1140
     ctggagtcaa gggattgcat aagtcactca ctgatgtggc tctggaacac cacgaggaat      1200
     gtgactgtgt gtgtagagga aacgcaggag ggtaactgca gccttcgtag cagcacacgt      1260
     gagcactggc attctgtgta cccccacaag caaccttcat ccccaccagc gttggccgca      1320
     gggctctcag ctgctgatgc tggctatggt aaagatctta ctcgtctcca accaaattct      1380
     cagttgtttg cttcaatagc cttcccctgc aggacttcaa gtgtcttcta aaagaccaga      1440
     ggcaccaaga ggagtcaatc acaaagcact gccttctaga ggaagcccag acaatggtct      1500
     tctgaccaca gaaacaaatg aaatgaatgt agatcgctag caaactctgg agtgacagca      1560
     tttcttttcc actgacagaa tggtgtagct tagttgtctt gatatgggca agtgatgtca      1620
     gcacaagaaa atggtgaaaa acacacactt gattgtgaac aatgcagaaa tacttggatt      1680
     tctccaacct gtttgcatag atagacagat gctctgtttt ctacaaactc aaagctttta      1740
     gagagcagct atgttaatag gaattaaatg tgccatgctg aaaggaaaga ctgaagtttt      1800
     caatgcttgg caacttctcc gcaatttgga ggaaaggtgc ggtcatggtt tggagaaagc      1860
     acacctgcac agaggagtgg ccttcccttc ccttccctct gaggtggttt ctgtgtttca      1920
     ttgtgtatat ttttatattc tccttttgac attataactg ttggcttttc taatcttgtt      1980
     aaatatttct atttttacca aaggtattta atattctttt ttatgacaac ctagagcaat      2040
     tatttttagc ttgataattt ttttttctaa acagaattgt tatagccaga agaacaaaga      2100
     tgattgatat aaaaatcttg ttgctctgac aaaaacatat gtatttcttt cttgtatggt      2160
     gctagagctt agcgtcatct gcatttgaaa agatggaatg gggaagtttt tagaattggt      2220
     aggtcgcagg gacagtttga taacaactgt actatcatca attcccaatt ctgttcttag      2280
     agctacgaac agaacagagc ttgagtaaat atggagccat tgctaaccta cccctttcta      2340
     tgggaaatag gagtatagct cagagaagca cgtccccaga aacctcgacc atttctaggc      2400
     acagtgttct gggctatgct gcgctgtatg gacatatcct atttatttca atactagggt      2460
     tttattacct ttaaactctg ctccatacac ttgtattaat acatggatat ttttatgtac      2520
     agaagtatat catttaagga gttcacttat tatactcttt ggcaattgca aagaaaatca      2580
     acataataca ttgcttgtaa atgcttaatc tgtgcccaag ttttgtggtg actatttgaa      2640
     ttaaaatgta ttgaatcatc aaataaaata atctggctat tttggggaca aa              2692
//


spacer
spacer