Dbfetch

ID   AF113226; SV 1; linear; mRNA; HTC; HUM; 1754 BP.
XX
AC   AF113226;
XX
DT   12-DEC-2000 (Rel. 66, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens MSTP046 mRNA, complete cds.
XX
KW   HTC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1754
RA   Liu B., Liu Y.Q., Wang X.Y., Zhao B., Sheng H., Zhao X.W., Liu S., Xu Y.Y.,
RA   Ye J., Song L., Gao Y., Zhang C.L., Zhang J., Wei Y.J., Cao H.Q., Zhao Y.,
RA   Liu L.S., Ding J.F., Gao R.L., Wu Q.Y., Qiang B.Q., Yuan J.G., Liew C.C.,
RA   Zhao M.S., Hui R.T.;
RT   ;
RL   Submitted (15-DEC-1998) to the INSDC.
RL   Molecular Medical Center for Cardiovascular Disease, Cardiovascular
RL   Institute, CAMS & PUMC, 167, Bei Li Shi Lu, Beijing 100037, P.R. China
XX
DR   MD5; 5f0a34a3060f0f1e31bc1d471874c5c1.
DR   Ensembl-Gn; ENSG00000111596; homo_sapiens.
DR   Ensembl-Tr; ENST00000229195; homo_sapiens.
DR   Ensembl-Tr; ENST00000418359; homo_sapiens.
DR   Ensembl-Tr; ENST00000551043; homo_sapiens.
DR   Ensembl-Tr; ENST00000551483; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1754
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="heart"
FT                   /db_xref="taxon:9606"
FT   CDS             635..1732
FT                   /codon_start=1
FT                   /product="MSTP046"
FT                   /db_xref="GOA:Q9NZN8"
FT                   /db_xref="H-InvDB:HIT000069779.12"
FT                   /db_xref="HGNC:HGNC:7878"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="PDB:4C0D"
FT                   /db_xref="PDB:4C0F"
FT                   /db_xref="PDB:5FU6"
FT                   /db_xref="PDB:5FU7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9NZN8"
FT                   /protein_id="AAG39297.1"
FT                   /translation="MPKQQPSRQPFTVNSMSGFGMNRNQAFGMNNSLSSNIFNGTDGSE
FT                   NVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNED
FT                   FPALPGSSYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVL
FT                   PDGRVTNIPQGMVTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYP
FT                   KFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVL
FT                   QLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFH
FT                   LEYDKLEERPHLPSTFNYNPAQQAF"
XX
SQ   Sequence 1754 BP; 575 A; 388 C; 381 G; 410 T; 0 other;
     aaaattcatg cgagggagac gtggtgggcg gtccttcctg tgacacgacc cttgagtgac        60
     agttctattt gattgcctcc ggtactgtga ggaaaggaca cgactctatg gtgaggactg       120
     atggacatac attatctgag aaaagaaact accaggtgac aaacagcatg tttggtgctt       180
     caagaaagaa gtttgtagag ggggtcgaca gtgactacca tgacgaaaac atgtactaca       240
     gccagtcttc tatgtttcca catcggtcag aaaaagatat gctggcatca ccatctacat       300
     caggtcagct gtctcagttt ggggcaagtt tatacgggca acaaagtgca ctaggccttc       360
     caatgagggg gatgagcaac aatacccctc agttaaatcg cagcttatca caaggcactc       420
     agttaccgag ccacgtcacg ccaacaacag gggtaccaac aatgtcactt cacacgcctc       480
     catctccaag caggggtatt ttgcctatga atcctaggaa tatgatgaac cactcccagg       540
     ttggtcaggg cattggaatt cctagcagga caaatagcat gagcaggttc aaggttaggt       600
     agccccaaca gaagcttcgc caagcataat atgtatgcca aagcagcagc cttctcgaca       660
     gccttttact gtgaacagta tgtctggatt tggaatgaac aggaatcagg catttggaat       720
     gaataactcc ttatcaagta acatttttaa tggaacagac ggaagtgaaa atgtgacagg       780
     attggacctt tcagatttcc cagcattagc agaccgaaac aggagggaag gaagtggtaa       840
     cccaactcca ttaataaacc ccttggctgg aagagctcct tatgttggaa tggtaacaaa       900
     accagcaaat gaacaatccc aggacttctc aatacacaat gaagattttc cagcattacc       960
     aggctccagc tataaagatc caacatcaag taatgatgac agtaaatcta atttgaatac      1020
     atctggcaag acaacttcaa gtacagatgg acccaaattc cctggagata aaagttcaac      1080
     aacacaaaat aataaccagc agaaaaaagg gatccaggtg ttacctgatg gtcgggttac      1140
     taacattcct caagggatgg tgacggacca atttggaatg attggcctgt taacatttat      1200
     cagggcagca gagacagacc caggaatggt acatcttgca ttaggaagtg acttaacaac      1260
     attaggcctc aatctgaact ctcctgaaaa tctctacccc aaatttgcgt caccctgggc      1320
     atcttcacct tgtcgacctc aagacataga cttccatgtt ccatctgagt acttaacgaa      1380
     cattcacatt agggataagc tggctgcaat aaaacttggc cgatatggtg aagaccttct      1440
     cttctatctc tattacatga atggaggaga cgtattacaa cttttagctg cagtggagct      1500
     ttttaaccgt gattggagat accacaaaga agaacgagta tggattacca gggcaccagg      1560
     catggagcca acaatgaaaa ccaataccta tgagagggga acatattact tctttgactg      1620
     tcttaactgg aggaaagtag ctaaggagtt ccatctggaa tatgacaaat tagaagaacg      1680
     gcctcacctg ccatccacct tcaactacaa ccctgctcag caagccttct aaaaaaaaaa      1740
     aaaaaaaaaa aaaa                                                        1754
//