Dbfetch

ID   AF111172; SV 1; linear; mRNA; STD; MUS; 2270 BP.
XX
AC   AF111172;
XX
DT   06-JAN-1999 (Rel. 58, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus lysosomal pepstatin insensitive protease precursor (Cln2)
DE   mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2270
RX   DOI; 10.1086/302427.
RX   PUBMED; 10330339.
RA   Sleat D.E., Gin R.M., Sohar I., Wisniewski K., Sklower-Brooks S.,
RA   Pullarkat R.K., Palmer D.N., Lerner T.J., Boustany R.M., Uldall P.,
RA   Siakotos A.N., Donnelly R.J., Lobel P.;
RT   "Mutational analysis of the defective protease in classic late-infantile
RT   neuronal ceroid lipofuscinosis, a neurodegenerative lysosomal storage
RT   disorder";
RL   Am. J. Hum. Genet. 64(6):1511-1523(1999).
XX
RN   [2]
RP   1-2270
RA   Sleat D.E., Lobel P.;
RT   "Murine homologue of the lysosomal pepstatin insensitive protease which is
RT   deficient in human classical late infantile neuronal ceroid
RT   lipofuscinosis";
RL   Unpublished.
XX
RN   [3]
RP   1-2270
RA   Sleat D.E., Lobel P.;
RT   ;
RL   Submitted (07-DEC-1998) to the INSDC.
RL   CABM, UMDNJ, 679 Hoes Lane, Piscataway, NJ 08854, USA
XX
DR   MD5; 61c8ce7d2c51e1ac18c6bae41bbc037d.
DR   Ensembl-Gn; ENSMUSG00000030894; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032764; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032744; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032677; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032750; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032459; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033255; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031789; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032433; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032586; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032539; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032677; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032571; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033276; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031502; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031906; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000033184; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0085705; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0085775; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0085721; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0085744; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085302; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086245; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085822; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085246; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0085441; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085293; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0085484; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085335; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0086531; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085235; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084359; mus_musculus_wsbeij.
DR   EuropePMC; PMC1377895; 10330339.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2270
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /note="sequence derived from complete sequencing of IMAGE
FT                   Consortium clones 552099, 440347, and 369931"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..28
FT                   /gene="Cln2"
FT   CDS             29..1717
FT                   /codon_start=1
FT                   /gene="Cln2"
FT                   /product="lysosomal pepstatin insensitive protease
FT                   precursor"
FT                   /db_xref="GOA:O89023"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="MGI:MGI:1336194"
FT                   /db_xref="UniProtKB/Swiss-Prot:O89023"
FT                   /protein_id="AAD03083.1"
FT                   /translation="MGLQARLLGLLALVIAGKCTYNPEPDQRWMLPPGWVSLGRVDPEE
FT                   ELSLTFALKQRNLERLSELVQAVSDPSSPQYGKYLTLEDVAELVQPSPLTLLTVQKWLS
FT                   AAGARNCDSVTTQDFLTCWLSVRQAELLLPGAEFHRYVGGPTKTHVIRSPHPYQLPQAL
FT                   APHVDFVGGLHRFPPSSPRQRPEPQQVGTVSLHLGVTPSVLRQRYNLTAKDVGSGTTNN
FT                   SQACAQFLEQYFHNSDLTEFMRLFGGSFTHQASVAKVVGKQGRGRAGIEASLDVEYLMS
FT                   AGANISTWVYSSPGRHEAQEPFLQWLLLLSNESSLPHVHTVSYGDDEDSLSSIYIQRVN
FT                   TEFMKAAARGLTLLFASGDTGAGCWSVSGRHKFRPSFPASSPYVTTVGGTSFKNPFLIT
FT                   DEVVDYISGGGFSNVFPRPPYQEEAVAQFLKSSSHLPPSSYFNASGRAYPDVAALSDGY
FT                   WVVSNMVPIPWVSGTSASTPVFGGILSLINEHRILNGRPPLGFLNPRLYQQHGTGLFDV
FT                   THGCHESCLNEEVEGQGFCSGPGWDPVTGWGTPNFPALLKTLLNP"
FT   sig_peptide     29..76
FT                   /gene="Cln2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   mat_peptide     77..1714
FT                   /gene="Cln2"
FT                   /product="lysosomal pepstatin insensitive protease"
FT   3'UTR           1715..2270
FT                   /gene="Cln2"
XX
SQ   Sequence 2270 BP; 505 A; 656 C; 529 G; 580 T; 0 other;
     atgactacag atcagcctga aagccaaaat gggactccaa gcccgcctcc tagggctcct        60
     tgctctcgtc atcgccggca aatgcactta caaccctgag ccggaccagc ggtggatgct       120
     gcctccaggc tgggtgtccc tgggccgcgt ggatcccgag gaagagctga gtctcacttt       180
     tgcgctgaaa cagcggaacc tggaaagact ctcggagctg gtgcaggctg tgtcggatcc       240
     tagctctcct caatatggaa agtacctaac cctggaggat gtagctgagc tggttcaacc       300
     atcacccctg accctcctca ctgtccaaaa gtggctctca gcagctggag cccggaactg       360
     cgattcagtg accacccagg actttctgac ttgctggctg agtgtccgac aggctgagct       420
     gctgctccca ggagctgagt ttcatcgcta tgtaggggga cctacaaaga cccatgttat       480
     aaggtcccca catccctacc agcttcccca ggccttggcc cctcatgtgg attttgtggg       540
     ggggctgcac cgtttccccc cttcatctcc aagacaacgt ccagaaccac aacaggtagg       600
     aactgttagc ctgcacttgg gagtgactcc gtctgtgctc cgtcagcgat acaacctgac       660
     agccaaagat gtgggctcag gcaccaccaa caatagccag gcctgtgccc agttcctgga       720
     acagtacttc cataactcgg atctgactga gttcatgcgc ctattcggtg gcagttttac       780
     acaccaggcc tcagtagcaa aagttgttgg aaagcaaggg cgaggccgag ctgggatcga       840
     ggccagtcta gatgtggaat acctgatgag tgctggtgcc aatatctcca cttgggtcta       900
     cagtagccct ggccgccatg aggcacagga gcccttctta caatggctcc tgcttcttag       960
     caatgagtca tctttgccac atgtacatac tgtgagttac ggagacgatg aagactccct      1020
     cagcagcatc tacatccaga gagtcaacac tgagttcatg aaggctgctg ctcggggtct      1080
     caccctcctt tttgcctcag gtgacactgg agctgggtgt tggtctgtct ccggaagaca      1140
     caagttccgc cctagcttcc ctgcttccag cccctatgtt actacagttg gaggaacctc      1200
     cttcaagaat cctttcctca tcacagatga agtagttgac tatatcagtg gtggaggctt      1260
     cagcaatgtt ttcccacggc ctccctacca ggaggaagca gtggcccagt tcttgaaatc      1320
     cagctctcat ctaccaccat ccagttactt caatgctagt ggccgtgcct acccagatgt      1380
     tgccgcacta tctgatggct actgggtggt cagcaacatg gtccccattc catgggtatc      1440
     tggaacctcg gcctctactc cagtgtttgg gggaatttta tccttgataa atgagcacag      1500
     aatcctcaat ggccgccctc ctcttggctt tctcaacccc aggctctatc agcagcatgg      1560
     gacaggactc tttgatgtaa cccacggctg ccatgagtcc tgtctgaatg aagaagtgga      1620
     gggtcagggt ttctgctctg gtcctggctg ggatcctgtg acaggttggg gaacacccaa      1680
     cttcccagcc ctactgaaga ccctgctcaa cccttgaccc tttcgtgcca tgacgagaaa      1740
     gcagaactgt tccctgtact aaaagggaag gctcagtttc ttgttattcc tcgatagaag      1800
     ccctgctgaa ctcctgttgc ctgctgcaga tagcttctcc ctaaccctca gatgctgtga      1860
     acaggactca actctcaatc ctactgtgtg ccatcaaact caggtctcca aacttctact      1920
     tcaagatcct caacaagatg ctataaccag catattttgt ctcaccccaa ccccatctct      1980
     ccttcctctt tccagcttga gatgtgaaag cagggcaaga aggttcagtc ttccattact      2040
     gacactagca ggtccaccca acgcttacca cctctgcact gaccgtacac tctatttctc      2100
     ttcgggtttg cttttccgtt cactgaagtg agacctttga ctaatcgttt tgtctttctt      2160
     ctctcggcac tgaagtacaa tggtctcccc aatgttttat ccagttatac ccttttcagt      2220
     gtttgtttta tgggttttct tatttaagaa caggttgtca aaaaaccatt                 2270
//