spacer

EBI Dbfetch

ID   AF111108; SV 1; linear; mRNA; STD; MUS; 3608 BP.
XX
AC   AF111108;
XX
DT   11-MAR-1999 (Rel. 59, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus transient receptor potential 2 (Trp2) mRNA, alternatively
DE   spliced, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3608
RX   DOI; 10.1073/pnas.96.5.2060.
RX   PUBMED; 10051594.
RA   Vannier B., Peyton M., Boulay G., Brown D., Qin N., Jiang M., Zhu X.,
RA   Birnbaumer L.;
RT   "Mouse trp2, the homologue of the human trpc2 pseudogene, encodes mTrp2, a
RT   store depletion-activated capacitative Ca2+ entry channel";
RL   Proc. Natl. Acad. Sci. U.S.A. 96(5):2060-2064(1999).
XX
RN   [2]
RP   1-3608
RA   Vannier B., Peyton M., Zhu X., Birnbaumer L.;
RT   ;
RL   Submitted (04-DEC-1998) to the INSDC.
RL   Anesthesiology, UCLA, 10833 Le Conte Avenue, Los Angeles, CA 90095-1778,
RL   USA
XX
DR   MD5; 4a2f1f92b2e55ea69ea6fdca4ec2b1c7.
DR   Ensembl-Gn; ENSMUSG00000070425; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106943; mus_musculus.
DR   EuropePMC; PMC24754; 10611319.
DR   EuropePMC; PMC2481268; 18554410.
DR   EuropePMC; PMC26736; 10051594.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3608
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             7..3525
FT                   /codon_start=1
FT                   /gene="Trp2"
FT                   /product="transient receptor potential 2"
FT                   /note="putative capacitative calcium entry channel;
FT                   alternatively spliced"
FT                   /db_xref="GOA:Q9R244"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002153"
FT                   /db_xref="InterPro:IPR002706"
FT                   /db_xref="InterPro:IPR005458"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013555"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:109527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R244"
FT                   /protein_id="AAD17196.1"
FT                   /translation="MLMSRTDSKSGKNRSGVRMFKDGDFLTPASGESWDRLRLTCSQPF
FT                   TRHQSFGLAFLRVRSSLGSLADPVVDPSAPGSSGLNQNSTDVLESDPRPWLTNPSIRRT
FT                   FFPDPQTSTKEISELKGMLKQLQPGPLGRAARMVLSAARKAPPASVVSPNNSHGEPGPS
FT                   RAESAEPRAEEPNRKTAVGRRKRRKVQEPRRSLSNSSSQPNRRTGRTRQRQHRPQTKSD
FT                   DGGVQAAGQCPICAGFFSIETLPQHAATCGESPPPQPASPASLSSSESVLRRHHVALTP
FT                   VPLVPKPQPNWTEIVNKKLKFPPTLLRAIQEGQLGLVQQLLESSSDASGAGPGGPLRNV
FT                   EESEDRSWREALNLAIRLGHEVITDVLLANVKFDFRQIHEALLVAVDTNQPAVVRRLLA
FT                   RLEREKGRKVDTKSFSLAFFDSSIDGSRFAPGVTPLTLACQKDLYEIAQLLMDQGHTIA
FT                   RPHPVSCACLECSNARRYDLLKFSLSRINTYRGIASRAHLSLASEDAMLAAFQLSRELR
FT                   RLARKEPEFKPQYIALESLCQDYGFELLGMCRNQSEVTAVLNDLGEDSETEPEAEGLGQ
FT                   AFEEGIPNLARLRLAVNYNQKQFVAHPICQQVLSSIWCGNLAGWRGSTTIWRLFVASLI
FT                   FLTMPFLCIGYWLAPKSQLGRLLKIPVLKFLLHSASYLWFLIFLLGESLVMETQLSTFK
FT                   GRSQSVWETSLHMIWVTGFLWFECKEVWIEGLRSYLLDWWNFLDVVILSLYLASFALRL
FT                   LLAGLAYMHCRDASDSTTCRCFTTAERSEWRTEDPQFLAEVLFTVTSMLSFTRLAYILP
FT                   AHESLGTLQISIGKMIDDMIRFMFILMIILTAFLCGLNNIYVPYQESEKLGNFNETFQF
FT                   LFWTMFGMEEHTVVDMPQFLVPEFVGRAMYGIFTIVMVIVLLNMLIAMITNSFQKIEDD
FT                   ADVEWKFARSKLYLSYFREGLTLPVPFNILPSPKAAFYLVRRIFRFLCCGSSCCKAKKS
FT                   DYPPIGTFTNPGARAGSAGEGERVSYRLRVIKALVQRYIETARREFEETRRKDLGNRLT
FT                   ELTKTVSRLQSEVASVQKNLAAGGAPRPPDGASILSRYITRVRNSFQNLGPPTSDTPAE
FT                   LTMPGIVETEVSLGDGLDGTGEAGAPAPGEPGSSSSAHVLVHREQEAEGSGDLLLEGDL
FT                   ETKGES"
XX
SQ   Sequence 3608 BP; 749 A; 1066 C; 997 G; 796 T; 0 other;
     gccaccatgc taatgtcccg cactgactcc aagtcgggga agaaccgctc aggggtccgg        60
     atgtttaaag atggtgattt cctgactcca gcctcaggag agtcctggga tcgacttcga       120
     ttgacctgct cccaaccttt cacacgtcat cagtcctttg gcctggcctt cctacgagtg       180
     cgttcctctc tgggctctct ggctgaccct gtagtagatc cctcagcccc tgggagctct       240
     gggcttaacc agaactctac agatgtgctg gagtctgatc ctaggccctg gctgactaat       300
     ccttctatcc ggaggacatt cttccccgat ccccagacga gcaccaagga aatttcagag       360
     ctcaagggta tgttgaagca gttgcagcca gggcctctgg ggcgggcagc ccgcatggtg       420
     ctttctgctg cccgtaaggc ccctccagcc agtgtggtaa gcccaaacaa cagccacgga       480
     gaaccaggtc ccagccgtgc agagagtgca gagcccagag cagaagaacc aaacaggaag       540
     acggctgtgg gcagaaggaa gaggaggaaa gtgcaggagc caaggagatc gttgtccaac       600
     tcgagttctc agccaaatag gaggacagga aggacaagac aaagacagca ccgacctcag       660
     accaaaagtg atgacggtgg tgtgcaggct gctggacagt gtcctatttg tgcaggtttc       720
     ttcagtattg agactcttcc ccagcatgct gcaacttgtg gagagagccc cccaccccag       780
     ccagcttctc ctgcctcctt gtcttcctcg gagtccgtgc tgagacgtca tcatgtggca       840
     ctaacacccg ttccccttgt ccccaagcca cagcccaact ggactgagat tgtgaacaaa       900
     aagctcaaat tcccccccac actcctgcgt gccatccagg agggccagct gggtcttgtg       960
     cagcagctgc tggaatccag ttccgatgcc tcgggtgctg ggccaggtgg tcctctgcgg      1020
     aatgtggaag agtctgagga ccgctcctgg agggaagccc tcaacctggc catccgcctg      1080
     ggccacgagg tcatcactga tgttctgctg gccaatgtca aattcgactt tcggcagatc      1140
     cacgaagccc tgctagtggc tgtggacaca aaccagccag cagtggtgcg tcgcctgcta      1200
     gcgcggctgg agcgggagaa aggtcgaaaa gtagacacca agtctttctc tctagccttc      1260
     tttgactcat cgattgatgg ctcccgcttt gcccctggtg tcactccact cacactggcc      1320
     tgccagaagg acctgtatga gattgcccag ctgcttatgg accagggcca taccattgct      1380
     cggccccacc cagtttcctg tgcctgcctc gagtgcagca atgcccgccg atacgacctg      1440
     ctgaagttct cactatcccg aatcaacacc taccgaggca ttgcaagccg ggctcacctc      1500
     tcgctggcca gtgaggatgc catgctggcc gcttttcagc tcagccggga gctcaggcgc      1560
     cttgcacgaa aggagcctga gtttaagcct cagtacattg ccctggagtc tctctgccag      1620
     gactatggct tcgagttgct gggcatgtgc cgaaatcaga gtgaggtcac cgcagtgctc      1680
     aatgacctgg gtgaggatag tgagactgag cctgaggctg agggcctggg tcaggccttt      1740
     gaggagggca tccccaacct ggcaagactg cggttggctg tcaactacaa ccagaaacag      1800
     tttgtagcac atcccatctg ccagcaagtt ctgtcttcca tctggtgtgg gaacctggct      1860
     ggctggcgtg gaagcaccac catctggagg ctctttgttg cctccctcat cttcctcacc      1920
     atgcccttcc tctgcattgg ctactggctg gcgcccaagt cccagctggg ccgcctgctg      1980
     aagatcccgg tgctgaagtt cctgctgcat tctgcctcct acctgtggtt ccttatcttc      2040
     ttgctgggag agtctctggt catggagacc cagctgagca ccttcaaagg ccgcagccag      2100
     agtgtctggg agacttcact acatatgatc tgggtcacag gcttcctatg gtttgaatgc      2160
     aaggaggtgt ggatcgaggg cttgcggagc tacctcctgg actggtggaa cttcctggac      2220
     gtggtcatcc tgtccctgta cttggcatcc tttgcactgc gcctcctcct ggctgggctt      2280
     gcctacatgc actgccgtga tgcctcagac agcaccacct gccgctgttt caccacagct      2340
     gagagaagtg agtggcgtac agaggacccc cagtttctgg ctgaggtgct ctttactgtc      2400
     accagcatgc tcagcttcac ccgactggca tatattctgc cagctcacga atcgctgggc      2460
     acactgcaga tctccatcgg caagatgatt gacgacatga tccggttcat gttcatcctc      2520
     atgatcatcc tgactgcctt cctctgtggc ctcaacaaca tctatgtgcc ctaccaggaa      2580
     tccgagaagc taggcaattt caacgaaacg ttccagtttc tcttttggac catgttcggc      2640
     atggaagagc acacagtggt ggacatgcct cagttcctgg tgcctgagtt cgtgggcagg      2700
     gccatgtacg gcatctttac catcgtcatg gtcattgtgc tacttaacat gcttattgcc      2760
     atgatcacca actccttcca gaagatcgag gatgatgctg atgtggagtg gaagtttgct      2820
     cgctccaagc tctacctgtc ctacttccga gagggtctga cgctgcctgt gccctttaac      2880
     atcctgccat ccccaaaggc cgccttctac ctcgtcagga gaattttccg gttcctttgc      2940
     tgtggctcct cctgctgcaa agccaagaag tcggactacc cgcccatcgg gacctttacc      3000
     aaccccgggg caagggcggg ctccgccggg gaaggagaac gcgtgtccta ccgccttcga      3060
     gtcatcaagg ctctggtgca gcgctacata gagactgccc ggcgcgagtt cgaggagacc      3120
     cgtcggaaag acctgggcaa cagactgaca gagctgacca agactgtgtc tcgactgcaa      3180
     agcgaggtgg ccagtgtgca gaagaacctg gcggcgggag gggcaccacg gcctccggat      3240
     ggtgccagca tcctcagtag atacatcacc cgagtgcgca acagcttcca gaacctgggc      3300
     ccccctacct ctgacacccc agcagagctg actatgcctg ggattgtgga gaccgaagtc      3360
     tctttaggag atggccttga tggcacaggt gaagctggag ctcccgctcc tggagagccc      3420
     ggctcttcct cctctgccca tgtgctggtt cacagggagc aagaagcaga ggggtcaggg      3480
     gacttgctcc tggaaggaga tctggagacc aagggcgagt cctaaggcaa cagaagggtc      3540
     tcttctgtca ctaagtgcag ctgctgtgtt gggtagagcc agggtctcac agtagaagac      3600
     catggtgc                                                               3608
//


spacer
spacer